- Toll Free: 888-880-0001
- Phone: 858-552-6979
- Email: info@avivasysbio.com
- $55: Antibody & Protein in US
- $55 + $25/Kit in US
- Contact us for international orders.
FABP1 Antibody (OAAN01190)
Datasheets/Manuals | Printable datasheet for anti-FABP1 (OAAN01190) |
---|
Predicted Species Reactivity | Human, Mouse, Rat |
---|---|
Product Format | Liquid PBS with 0.02% sodium azide, 50% glycerol (pH 7.3) |
Clonality | Polyclonal |
Isotype | IgG |
Host | Rabbit |
Conjugation | Unconjugated |
Application | WB, IHC, IF |
Reconstitution and Storage | Store at -20°C. Avoid repeated freeze/thaw cycles. |
Immunogen | Recombinant protein of human FABP1 containing a sequence corresponding to amino acids 1-127 of human FABP1. |
Purification | Affinity purified against immunogen |
Peptide Sequence | MSFSGKYQLQSQENFEAFMKAIGLPEELIQKGKDIKGVSEIVQNGKHFKFTITAGSKVIQNEFTVGEECELETMTGEKVKTVVQLEGDNKLVTTFKNIKSVTELNGDIITNTMTLGDIVFKRISKRI |
Application Info | WB: 1:2000~6000 IF/ICC: 1:50~200 |
Storage Buffer | PBS with 0.02% sodium azide, 50% glycerol, pH7.3. |
Gene Symbol | FABP1 |
---|---|
Gene Full Name | fatty acid binding protein 1, liver |
Alias Symbols | FABPL, L-FABP |
NCBI Gene Id | 2168 |
Protein Name | Fatty acid-binding protein, liver |
Uniprot ID | P07148 |
Protein Accession # | NP_001434.1 |
Nucleotide Accession # | NM_001443.2 |
Molecular Weight | 14 kDa |
- Protocol:
- Reconstitution & Storage Instructions
- Western Blotting/Immunoblotting (WB/IB) Protocol
- Immunohistochemistry (IHC) Protocol
- Immunocytochemistry (ICC) Protocol
- Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
- Blocking Peptide Competition Protocol (BPCP)
- Immunoprecipitation (IP) Protocol
- Antibody Array (AA) Protocol
- Tips Information:
-
See our General FAQ page.
-
What is the species homology for "FABP1 Antibody (OAAN01190)"?
The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human, Mouse, Rat".
-
How long will it take to receive "FABP1 Antibody (OAAN01190)"?
This item is available "Domestic: within 1-2 weeks delivery | International: 1-2 weeks".
-
What buffer format is "FABP1 Antibody (OAAN01190)" provided in?
This item is provided in "Liquid PBS with 0.02% sodium azide, 50% glycerol (pH 7.3)".
Additional format options may be available. For more information please contact info@avivasysbio.com. -
What are other names for "FABP1 Antibody (OAAN01190)"?
This target may also be called "FABPL, L-FABP" in publications.
-
What is the shipping cost for "FABP1 Antibody (OAAN01190)"?
The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.
-
What is the guarantee for "FABP1 Antibody (OAAN01190)"?
All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.
-
Can I get bulk pricing for "FABP1 Antibody (OAAN01190)"?
You can get bulk pricing for this item by going here.
-
What is the molecular weight of the protein?
The molecular weight reported by Uniprot for this item is "14 kDa".
Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics. -
What protocols are available for "FABP1 Antibody (OAAN01190)"?
We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.
-
What are positive controls for "FABP1"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What are negative controls for "FABP1"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What other proteins interact with "FABP1"?
This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.
-
What biological processes are associated with "FABP1"?
This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.
-
What cellular components are associated with "FABP1"?
This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.
-
What protein functions are associated with "FABP1"?
This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.