F8 Antibody - C-terminal region (ARP60040_P050)

Catalog No: ARP60040_P050

WB Suggested Anti-F8 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: 721_B cell lysate

Host: Rabbit
Target Name: F8
Sample Type: 721_B Whole Cell
Lane A: Primary Antibody
Lane B: Primary Antibody + Blocking Peptide
Primary Antibody Concentration: 1ug/ml
Peptide Concentration: 5ug/ml
Lysate Quantity: 25ug/lane
Gel Concentration: 0.12%

Host: Rabbit
Target Name: F8
Sample Tissue: Human Ovary Tumor
Antibody Dilution: 1ug/ml

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Cow, Dog, Horse, Rabbit, Sheep
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human F8
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 86%; Dog: 77%; Horse: 93%; Human: 100%; Rabbit: 86%; Sheep: 86%
• Peptide Sequence: Synthetic peptide located within the following region: IMVTFRNQASRPYSFYSSLISYEEDQRQGAEPRKNFVKPNETKTYFWKVQ
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-F8 (ARP60040_P050) antibody is Catalog # AAP60040 (Previous Catalog # AAPP46191)

Target Info

• Gene Symbol: F8
• Gene Full Name: Coagulation factor VIII, procoagulant component
• Alias Symbols: AHF, F8B, F8C, HEMA, FVIII, DXS1253E
• NCBI Gene Id: 2157
• Protein Name: Coagulation factor VIII
• Description of Target: This gene encodes coagulation factor VIII, which participates in the intrinsic pathway of blood coagulation; factor VIII is a cofactor for factor IXa which, in the presence of Ca+2 and phospholipids, converts factor X to the activated form Xa. This gene produces two alternatively spliced transcripts. Transcript variant 1 encodes a large glycoprotein, isoform a, which circulates in plasma and associates with von Willebrand factor in a noncovalent complex. This protein undergoes multiple cleavage events. Transcript variant 2 encodes a putative small protein, isoform b, which consists primarily of the phospholipid binding domain of factor VIIIc. This binding domain is essential for coagulant activity. Defects in this gene results in hemophilia A, a common recessive X-linked coagulation disorder.
• Uniprot ID: P00451
• Protein Accession #: NP_000123
• Nucleotide Accession #: NM_000132
• Protein Size (# AA): 2351
• Molecular Weight: 79kDa
• Protein Interactions: UBQLN1; GGA1; MCFD2; PHYH; LMAN1; F9; F10; VWF; F2; PROS1; PROC; HSPA5; CANX; CALR; ASGR2; LRP1;