Search Antibody, Protein, and ELISA Kit Solutions

F3 Antibody (OAAF08021)

100 ug
$299.00
In Stock
Request Bulk Order Quote

Conjugation Options

OAAF08021-FITC Conjugated

OAAF08021-HRP Conjugated

OAAF08021-Biotin Conjugated

Predicted Species Reactivity:
Human
Clonality:
Polyclonal
Host:
Rabbit
Application:
WB
Reconstitution and Storage:
Stable at -20C for at least 1 year.
Replacement Item:
This antibody may replace item sc-18786 from Santa Cruz Biotechnology.
Immunogen:
The antiserum was produced against synthesized peptide derived from the Internal region of human F3.
Purification:
The antibody was affinity-purified from rabbit antiserum by affinity-chromatography using peptide.
Peptide Sequence:
Synthetic peptide located within the following region: EFTPYLETNLGQPTIQSFEQVGTKVNVTVEDERTLVRRNNTFLSLRDVFG
Concentration:
1mg/ml
Datasheets/Manuals:
Printable datasheet for OAAF08021
Specificity:
F3 Antibody detects endogenous levels of F3 protein.
Formulation:
Rabbit IgG in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol.
Application Info:
WB: 1:500~1:1000
ELISA: 1:10000
Gene Symbol:
F3
Alias Symbols:
F3, Tissue factor, TF, Coagulation factor III, Thromboplastin, CD142
NCBI Gene Id:
2152
Swissprot Id:
P13726
Molecular Weight:
33 kDa
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express F3.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express F3.

Product Reviews

Protocol:
Tips Information:

Tell us what you think about this item!

Write A Review
    Please, wait...