- Toll Free: 888-880-0001
- Phone: 858-552-6979
- Email: info@avivasysbio.com
- $55: Antibody & Protein in US
- $55 + $25/Kit in US
- Contact us for international orders.
Datasheets/Manuals | Printable datasheet for anti-EZH2 (ARP88917_P050) antibody |
---|
Tested Species Reactivity | Mouse |
---|---|
Predicted Species Reactivity | Mouse |
Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Clonality | Polyclonal |
Host | Rabbit |
Application | WB |
Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of mouse EZH2 |
Purification | Affinity purified |
Peptide Sequence | Synthetic peptide located within the following region: INDEIFVELVNALGQYNDDDDDDDGDDPDEREEKQKDLEDNRDDKETCPP |
Concentration | 0.5 mg/ml |
Blocking Peptide | For anti-EZH2 (ARP88917_P050) antibody is Catalog # AAP88917 |
Gene Symbol | EZH2 |
---|---|
Gene Full Name | enhancer of zeste 2 polycomb repressive complex 2 subunit |
Alias Symbols | Enx-, Enx1, KMT6, Enx-1, Enx1h, mKIAA4065 |
NCBI Gene Id | 14056 |
Protein Name | histone-lysine N-methyltransferase EZH2 |
Description of Target | Polycomb group (PcG) protein. Catalytic subunit of the PRC2/EED-EZH2 complex, which methylates (H3K9me) and 'Lys-27' (H3K27me) of histone H3, leading to transcriptional repression of the affected target gene. Able to mono-, di- and trimethylate 'Lys-27' of histone H3 to form H3K27me1, H3K27me2 and H3K27me3, respectively. Displays a preference for substrates with less methylation, loses activity when progressively more methyl groups are incorporated into H3K27, H3K27me0 > H3K27me1 > H3K27me2. Compared to EZH1-containing complexes, it is more abundant in embryonic stem cells and plays a major role in forming H3K27me3, which is required for embryonic stem cell identity and proper differentiation. The PRC2/EED-EZH2 complex may also serve as a recruiting platform for DNA methyltransferases, thereby linking two epigenetic repression systems. Genes repressed by the PRC2/EED-EZH2 complex include HOXA7, HOXB6 and HOXC8. EZH2 can also methylate non-histone proteins such as the transcription factor GATA4 and the nuclear receptor RORA. Regulates the circadian clock via histone methylation at the promoter of the circadian genes. Essential for the CRY1/2-mediated repression of the transcriptional activation of PER1/2 by the CLOCK-ARNTL/BMAL1 heterodimer; involved in the di and trimethylation of 'Lys-27' of histone H3 on PER1/2 promoters which is necessary for the CRY1/2 proteins to inhibit transcription. |
Uniprot ID | Q61188 |
Protein Accession # | NP_031997.2 |
Nucleotide Accession # | NM_007971.2 |
Protein Size (# AA) | 746 |
Molecular Weight | 82 kDa |
- Protocol:
- Reconstitution & Storage Instructions
- Western Blotting/Immunoblotting (WB/IB) Protocol
- Immunohistochemistry (IHC) Protocol
- Immunocytochemistry (ICC) Protocol
- Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
- Blocking Peptide Competition Protocol (BPCP)
- Immunoprecipitation (IP) Protocol
- Antibody Array (AA) Protocol
- Tips Information:
-
See our General FAQ page.
-
What is the species homology for "EZH2 Antibody - middle region (ARP88917_P050)"?
The tested species reactivity for this item is "Mouse". This antibody is predicted to have homology to "Mouse".
-
How long will it take to receive "EZH2 Antibody - middle region (ARP88917_P050)"?
This item is available "Domestic: within 24 hours delivery | International: 3-5 days".
-
What buffer format is "EZH2 Antibody - middle region (ARP88917_P050)" provided in?
This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
Additional format options may be available. For more information please contact info@avivasysbio.com. -
What are other names for "EZH2 Antibody - middle region (ARP88917_P050)"?
This target may also be called "Enx-, Enx1, KMT6, Enx-1, Enx1h, mKIAA4065" in publications.
-
What is the shipping cost for "EZH2 Antibody - middle region (ARP88917_P050)"?
The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.
-
What is the guarantee for "EZH2 Antibody - middle region (ARP88917_P050)"?
All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.
-
Can I get bulk pricing for "EZH2 Antibody - middle region (ARP88917_P050)"?
You can get bulk pricing for this item by going here.
-
What is the molecular weight of the protein?
The molecular weight reported by Uniprot for this item is "82 kDa".
Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics. -
What protocols are available for "EZH2 Antibody - middle region (ARP88917_P050)"?
We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.
-
What are positive controls for "EZH2"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What are negative controls for "EZH2"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What other proteins interact with "EZH2"?
This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.
-
What biological processes are associated with "EZH2"?
This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.
-
What cellular components are associated with "EZH2"?
This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.
-
What protein functions are associated with "EZH2"?
This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.