EZH2 Antibody - middle region (ARP88917_P050)

Catalog No: ARP88917_P050

Host: Rabbit
Target Name: EZH2
Sample Tissue: Mouse Heart lysates
Antibody Dilution: 1ug/ml

Product Info

• Tested Species Reactivity: Mouse
• Predicted Species Reactivity: Mouse
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of mouse EZH2
• Purification: Affinity purified
• Peptide Sequence: Synthetic peptide located within the following region: INDEIFVELVNALGQYNDDDDDDDGDDPDEREEKQKDLEDNRDDKETCPP
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-EZH2 (ARP88917_P050) antibody is Catalog # AAP88917

Target Info

• Gene Symbol: EZH2
• Gene Full Name: enhancer of zeste 2 polycomb repressive complex 2 subunit
• Alias Symbols: Enx-, Enx1, KMT6, Enx-1, Enx1h, mKIAA4065
• NCBI Gene Id: 14056
• Protein Name: histone-lysine N-methyltransferase EZH2
• Description of Target: Polycomb group (PcG) protein. Catalytic subunit of the PRC2/EED-EZH2 complex, which methylates (H3K9me) and 'Lys-27' (H3K27me) of histone H3, leading to transcriptional repression of the affected target gene. Able to mono-, di- and trimethylate 'Lys-27' of histone H3 to form H3K27me1, H3K27me2 and H3K27me3, respectively. Displays a preference for substrates with less methylation, loses activity when progressively more methyl groups are incorporated into H3K27, H3K27me0 > H3K27me1 > H3K27me2. Compared to EZH1-containing complexes, it is more abundant in embryonic stem cells and plays a major role in forming H3K27me3, which is required for embryonic stem cell identity and proper differentiation. The PRC2/EED-EZH2 complex may also serve as a recruiting platform for DNA methyltransferases, thereby linking two epigenetic repression systems. Genes repressed by the PRC2/EED-EZH2 complex include HOXA7, HOXB6 and HOXC8. EZH2 can also methylate non-histone proteins such as the transcription factor GATA4 and the nuclear receptor RORA. Regulates the circadian clock via histone methylation at the promoter of the circadian genes. Essential for the CRY1/2-mediated repression of the transcriptional activation of PER1/2 by the CLOCK-ARNTL/BMAL1 heterodimer; involved in the di and trimethylation of 'Lys-27' of histone H3 on PER1/2 promoters which is necessary for the CRY1/2 proteins to inhibit transcription.
• Uniprot ID: Q61188
• Protein Accession #: NP_031997.2
• Nucleotide Accession #: NM_007971.2
• Protein Size (# AA): 746
• Molecular Weight: 82 kDa