Search Antibody, Protein, and ELISA Kit Solutions

EZH1 Antibody - N-terminal region (ARP34235_P050)

100 ul

Regular Price: $319.00

Special Price: $229.00

In Stock
Request Bulk Order Quote

Conjugation Options

ARP34235_P050-FITC Conjugated

ARP34235_P050-HRP Conjugated

ARP34235_P050-Biotin Conjugated

Tested Species Reactivity:
Human
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality:
Polyclonal
Host:
Rabbit
Application:
WB, CHIP
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item:
This antibody may replace item sc-20349 from Santa Cruz Biotechnology.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human EZH1
Purification:
Affinity Purified
Predicted Homology Based on Immunogen Sequence:
Cow: 92%; Dog: 92%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 85%; Rabbit: 92%; Rat: 100%
Complete computational species homology data:
Anti-EZH1 (ARP34235_P050)
Peptide Sequence:
Synthetic peptide located within the following region: VDALNQYSDEEEEGHNDTSDGKQDDSKEDLPVTRKRKRHAIEGNKKSSKK
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-EZH1 (ARP34235_P050) antibody is Catalog # AAP34235 (Previous Catalog # AAPP05550)
Datasheets/Manuals:
Printable datasheet for anti-EZH1 (ARP34235_P050) antibody
Target Reference:
van (1998) Mol. Cell. Biol. 18 (6), 3572-3579
Gene Symbol:
EZH1
Official Gene Full Name:
Enhancer of zeste homolog 1 (Drosophila)
Alias Symbols:
KIAA0388, KMT6B
NCBI Gene Id:
2145
Protein Name:
Histone-lysine N-methyltransferase EZH1
Description of Target:
EZH1 is a component of a noncanonical Polycomb repressive complex-2 (PRC2) that mediates methylation of histone H3 (see MIM 602812) lys27 (H3K27) and functions in the maintenance of embryonic stem cell pluripotency and plasticity.
Swissprot Id:
Q92800
Protein Accession #:
NP_001982
Nucleotide Accession #:
NM_001991
Protein Size (# AA):
747
Molecular Weight:
85kDa
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express EZH1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express EZH1.
Protein Interactions:
SUZ12; UBC; GATA4; esc; EED; EZH2; EZH1; ZMYND11; E2F6;

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...