Search Antibody, Protein, and ELISA Kit Solutions

EZH1 Antibody - C-terminal region : FITC (ARP72412_P050-FITC)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP72412_P050 Unconjugated

ARP72412_P050-HRP Conjugated

ARP72412_P050-Biotin Conjugated

Gene Symbol:
NCBI Gene Id:
Swissprot Id:
Alias Symbols:
EZH1, KIAA0388,
Replacement Item:
This antibody may replace item sc-20349 from Santa Cruz Biotechnology.
Description of Target:
EZH1 is a component of a noncanonical Polycomb repressive complex-2 (PRC2) that mediates methylation of histone H3 lys27 (H3K27) and functions in the maintenance of embryonic stem cell pluripotency and plasticity.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express EZH1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express EZH1.
The immunogen is a synthetic peptide directed towards the C-terminal region of Human EZH1
Predicted Species Reactivity:
Peptide Sequence:
Synthetic peptide located within the following region: DVAGWGTFIKESVQKNEFISEYCGELISQDEADRRGKVYDKYMSSFLFNL
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer.
Reconstitution and Storage:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
0.5 mg/ml
Protein Interactions:
SUZ12; UBC; GATA4; esc; EED; EZH2; EZH1; ZMYND11; E2F6;
Blocking Peptide:
For anti-EZH1 (ARP72412_P050-FITC) antibody is Catalog # AAP72412
Printable datasheet for anti-EZH1 (ARP72412_P050-FITC) antibody
FITC (FAM): Excitation 495 nm/ Emission 520 nm

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...