Size:100 ul
$289.00
In Stock
SKU
ARP73849_P050-FITC
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP73849_P050 Unconjugated

ARP73849_P050-HRP Conjugated

ARP73849_P050-Biotin Conjugated

EYA4 Antibody - N-terminal region : FITC (ARP73849_P050-FITC)

Catalog#: ARP73849_P050-FITC
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Predicted Species ReactivityHuman
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer.
ClonalityPolyclonal
HostRabbit
ConjugationFITC (FAM): Excitation 495 nm/ Emission 520 nm
ApplicationWB
Reconstitution and StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Replacement ItemThis antibody may replace item sc-15106 from Santa Cruz Biotechnology.
ImmunogenThe immunogen is a synthetic peptide directed towards the N-terminal region of Human EYA4
PurificationAffinity Purified
Peptide SequenceSynthetic peptide located within the following region: DTFTGSVITSSGYSPRSAHQYSPQLYPSKPYPHILSTPAAQTMSAYAGQT
Concentration0.5 mg/ml
Blocking PeptideFor anti-EYA4 (ARP73849_P050-FITC) antibody is Catalog # AAP73849
Datasheets/ManualsPrintable datasheet for anti-EYA4 (ARP73849_P050-FITC) antibody
Gene SymbolEYA4
Alias SymbolsEYA4,
NCBI Gene Id2070
Description of TargetThis gene encodes a member of the eyes absent (EYA) family of proteins. The encoded protein may act as a transcriptional activator through its protein phosphatase activity, and it may be important for eye development, and for continued function of the mature organ of Corti. Mutations in this gene are associated with postlingual, progressive, autosomal dominant hearing loss at the deafness, autosomal dominant nonsyndromic sensorineural 10 locus. Defects in this gene are also associated with dilated cardiomyopathy 1J. Three transcript variants encoding distinct isoforms have been identified for this gene.
Swissprot IdO95677-3
Protein Size (# AA)452
Molecular Weight49kDa
Tissue ToolFind tissues and cell lines supported by DNA array analysis to express EYA4.
RNA SeqFind tissues and cell lines supported by RNA-seq analysis to express EYA4.
Protein InteractionsSIX1;
Write Your Own Review
You're reviewing:EYA4 Antibody - N-terminal region : FITC (ARP73849_P050-FITC)
Your Rating
Aviva ChIP Antibodies
Free Microscope
Assay Development
Aviva Tissue Tool