Search Antibody, Protein, and ELISA Kit Solutions

EYA4 Antibody - N-terminal region : FITC (ARP73849_P050-FITC)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP73849_P050 Unconjugated

ARP73849_P050-HRP Conjugated

ARP73849_P050-Biotin Conjugated

Gene Symbol:
EYA4
NCBI Gene Id:
2070
Swissprot Id:
O95677-3
Alias Symbols:
EYA4,
Replacement Item:
This antibody may replace item sc-15106 from Santa Cruz Biotechnology.
Description of Target:
This gene encodes a member of the eyes absent (EYA) family of proteins. The encoded protein may act as a transcriptional activator through its protein phosphatase activity, and it may be important for eye development, and for continued function of the mature organ of Corti. Mutations in this gene are associated with postlingual, progressive, autosomal dominant hearing loss at the deafness, autosomal dominant nonsyndromic sensorineural 10 locus. Defects in this gene are also associated with dilated cardiomyopathy 1J. Three transcript variants encoding distinct isoforms have been identified for this gene.
Protein Size (# AA):
452
Molecular Weight:
49kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express EYA4.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express EYA4.
Immunogen:
The immunogen is a synthetic peptide directed towards the N-terminal region of Human EYA4
Predicted Species Reactivity:
Human
Peptide Sequence:
Synthetic peptide located within the following region: DTFTGSVITSSGYSPRSAHQYSPQLYPSKPYPHILSTPAAQTMSAYAGQT
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer.
Reconstitution and Storage:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Concentration:
1 mg/ml
Protein Interactions:
SIX1;
Blocking Peptide:
For anti-EYA4 (ARP73849_P050-FITC) antibody is Catalog # AAP73849
Datasheets/Manuals:
Printable datasheet for anti-EYA4 (ARP73849_P050-FITC) antibody
Conjugation:
FITC (FAM): Excitation 495 nm/ Emission 520 nm

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...