Search Antibody, Protein, and ELISA Kit Solutions

EYA4 Antibody - N-terminal region (ARP73849_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP73849_P050-FITC Conjugated

ARP73849_P050-HRP Conjugated

ARP73849_P050-Biotin Conjugated

Gene Symbol:
EYA4
NCBI Gene Id:
2070
Swissprot Id:
O95677-3
Alias Symbols:
EYA4,
Replacement Item:
This antibody may replace item sc-15106 from Santa Cruz Biotechnology.
Description of Target:
This gene encodes a member of the eyes absent (EYA) family of proteins. The encoded protein may act as a transcriptional activator through its protein phosphatase activity, and it may be important for eye development, and for continued function of the mature organ of Corti. Mutations in this gene are associated with postlingual, progressive, autosomal dominant hearing loss at the deafness, autosomal dominant nonsyndromic sensorineural 10 locus. Defects in this gene are also associated with dilated cardiomyopathy 1J. Three transcript variants encoding distinct isoforms have been identified for this gene.
Protein Size (# AA):
452
Molecular Weight:
49kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express EYA4.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express EYA4.
Immunogen:
The immunogen is a synthetic peptide directed towards the N-terminal region of Human EYA4
Predicted Species Reactivity:
Human
Tested Species Reactivity:
Human
Peptide Sequence:
Synthetic peptide located within the following region: DTFTGSVITSSGYSPRSAHQYSPQLYPSKPYPHILSTPAAQTMSAYAGQT
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
SIX1;
Blocking Peptide:
For anti-EYA4 (ARP73849_P050) antibody is Catalog # AAP73849
Datasheets/Manuals:
Printable datasheet for anti-EYA4 (ARP73849_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...