Search Antibody, Protein, and ELISA Kit Solutions

EYA4 Antibody - middle region (ARP84780_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Gene Symbol:
EYA4
Official Gene Full Name:
EYA transcriptional coactivator and phosphatase 4
NCBI Gene Id:
2070
Protein Name:
eyes absent homolog 4
Swissprot Id:
O95677
Protein Accession #:
NP_001287941.1
Nucleotide Accession #:
NM_001301012.1
Alias Symbols:
CMD1J, DFNA10
Description of Target:
This gene encodes a member of the eyes absent (EYA) family of proteins. The encoded protein may act as a transcriptional activator through its protein phosphatase activity, and it may be important for eye development, and for continued function of the mature organ of Corti. Mutations in this gene are associated with postlingual, progressive, autosomal dominant hearing loss at the deafness, autosomal dominant non-syndromic sensorineural 10 locus. The encoded protein is also a putative oncogene that mediates DNA repair, apoptosis, and innate immunity following DNA damage, cellular damage, and viral attack. Defects in this gene are also associated with dilated cardiomyopathy 1J. Alternative splicing results in multiple transcript variants encoding distinct isoforms.
Protein Size (# AA):
639
Molecular Weight:
70 kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express EYA4.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express EYA4.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human EYA4
Predicted Species Reactivity:
Human
Tested Species Reactivity:
Human
Peptide Sequence:
Synthetic peptide located within the following region: IKDLDERTCRSSGSKSRGRGRKNNPSPPPDSDLERVFVWDLDETIIVFHS
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-EYA4 (ARP84780_P050) antibody is Catalog # AAP84780
Datasheets/Manuals:
Printable datasheet for anti-EYA4 (ARP84780_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...