Size:100 ul
Special Price $229.00 Regular Price $289.00
In Stock
SKU
ARP84780_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

EYA4 Antibody - middle region (ARP84780_P050)

Catalog#: ARP84780_P050
Domestic: within 24 hours delivery | International: 3-5 business days
More Information
Tested Species ReactivityHuman
Predicted Species ReactivityHuman
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human EYA4
PurificationAffinity purified
Peptide SequenceSynthetic peptide located within the following region: IKDLDERTCRSSGSKSRGRGRKNNPSPPPDSDLERVFVWDLDETIIVFHS
ConcentrationBatch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking PeptideFor anti-EYA4 (ARP84780_P050) antibody is Catalog # AAP84780
Datasheets/ManualsPrintable datasheet for anti-EYA4 (ARP84780_P050) antibody
Gene SymbolEYA4
Official Gene Full NameEYA transcriptional coactivator and phosphatase 4
Alias SymbolsCMD1J, DFNA10
NCBI Gene Id2070
Protein Nameeyes absent homolog 4
Description of TargetThis gene encodes a member of the eyes absent (EYA) family of proteins. The encoded protein may act as a transcriptional activator through its protein phosphatase activity, and it may be important for eye development, and for continued function of the mature organ of Corti. Mutations in this gene are associated with postlingual, progressive, autosomal dominant hearing loss at the deafness, autosomal dominant non-syndromic sensorineural 10 locus. The encoded protein is also a putative oncogene that mediates DNA repair, apoptosis, and innate immunity following DNA damage, cellular damage, and viral attack. Defects in this gene are also associated with dilated cardiomyopathy 1J. Alternative splicing results in multiple transcript variants encoding distinct isoforms.
Swissprot IdO95677
Protein Accession #NP_001287941.1
Nucleotide Accession #NM_001301012.1
Protein Size (# AA)639
Molecular Weight70 kDa
Tissue ToolFind tissues and cell lines supported by DNA array analysis to express EYA4.
RNA SeqFind tissues and cell lines supported by RNA-seq analysis to express EYA4.
Write Your Own Review
You're reviewing:EYA4 Antibody - middle region (ARP84780_P050)
Your Rating
Aviva Validation Data
Aviva Tips and Tricks
Free Microscope
Aviva Travel Grant