Search Antibody, Protein, and ELISA Kit Solutions

EYA2 Antibody - middle region : FITC (ARP76136_P050-FITC)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP76136_P050 Unconjugated

ARP76136_P050-HRP Conjugated

ARP76136_P050-Biotin Conjugated

Gene Symbol:
EYA2
NCBI Gene Id:
2139
Swissprot Id:
O00167-3
Protein Accession #:
NP_742108
Alias Symbols:
EYA2, EAB1,
Replacement Item:
This antibody may replace item sc-100325 from Santa Cruz Biotechnology.
Description of Target:
This gene encodes a member of the eyes absent (EYA) family of proteins. The encoded protein may be post-translationally modified and may play a role in eye development. A similar protein in mice can act as a transcriptional activator. Alternative splicing results in multiple transcript variants, but the full-length natures of all of these variants have not yet been determined.
Protein Size (# AA):
459
Molecular Weight:
50kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express EYA2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express EYA2.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of Human EYA2
Predicted Species Reactivity:
Human
Peptide Sequence:
Synthetic peptide located within the following region: GRSKRSSDPSPAGDNEIERVFVWDLDETIIIFHSLLTGTFASRYGKDTTT
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer.
Reconstitution and Storage:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Concentration:
0.5 mg/ml
Blocking Peptide:
For anti-EYA2 (ARP76136_P050-FITC) antibody is Catalog # AAP76136
Datasheets/Manuals:
Printable datasheet for anti-EYA2 (ARP76136_P050-FITC) antibody
Conjugation:
FITC (FAM): Excitation 495 nm/ Emission 520 nm
Target Reference:
N/A

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...