Aviva Systems Biology office will be closed for Memorial Day - May 27, 2019.
Please go here for more info.

Search Antibody, Protein, and ELISA Kit Solutions

EYA2 Antibody - middle region : FITC (ARP76136_P050-FITC)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP76136_P050 Unconjugated

ARP76136_P050-HRP Conjugated

ARP76136_P050-Biotin Conjugated

Gene Symbol:
NCBI Gene Id:
Swissprot Id:
Protein Accession #:
Alias Symbols:
Replacement Item:
This antibody may replace item sc-100325 from Santa Cruz Biotechnology.
Description of Target:
This gene encodes a member of the eyes absent (EYA) family of proteins. The encoded protein may be post-translationally modified and may play a role in eye development. A similar protein in mice can act as a transcriptional activator. Alternative splicing results in multiple transcript variants, but the full-length natures of all of these variants have not yet been determined.
Protein Size (# AA):
Molecular Weight:
Affinity purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express EYA2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express EYA2.
The immunogen is a synthetic peptide directed towards the middle region of Human EYA2
Predicted Species Reactivity:
Peptide Sequence:
Synthetic peptide located within the following region: GRSKRSSDPSPAGDNEIERVFVWDLDETIIIFHSLLTGTFASRYGKDTTT
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer.
Reconstitution and Storage:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
1 mg/ml
Blocking Peptide:
For anti-EYA2 (ARP76136_P050-FITC) antibody is Catalog # AAP76136
Printable datasheet for anti-EYA2 (ARP76136_P050-FITC) antibody
FITC (FAM): Excitation 495 nm/ Emission 520 nm
Target Reference:

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...