Search Antibody, Protein, and ELISA Kit Solutions

EXOSC9 Antibody - middle region (ARP82970_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Gene Symbol:
EXOSC9
Official Gene Full Name:
exosome component 9
NCBI Gene Id:
5393
Protein Name:
exosome complex component RRP45
Swissprot Id:
Q06265
Protein Accession #:
NP_001029366.1
Nucleotide Accession #:
NM_001034194.1
Alias Symbols:
p5, p6, RRP45, PMSCL1, Rrp45p, PM/Scl-75
Description of Target:
This gene encodes a component of the human exosome, a exoribonuclease complex which processes and degrades RNA in the nucleus and cytoplasm. This component may play a role in mRNA degradation and the polymyositis/scleroderma autoantigen complex. Alternative splicing results in multiple transcript variants.
Protein Size (# AA):
439
Molecular Weight:
48 kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express EXOSC9.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express EXOSC9.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human EXOSC9
Predicted Species Reactivity:
Human
Tested Species Reactivity:
Human
Peptide Sequence:
Synthetic peptide located within the following region: IIAEAEPPSEVVSTPVLWTPGTAQIGEGVENSWGDLEDSEKEDDEGGGDQ
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-EXOSC9 (ARP82970_P050) antibody is Catalog # AAP82970
Datasheets/Manuals:
Printable datasheet for anti-EXOSC9 (ARP82970_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...