Search Antibody, Protein, and ELISA Kit Solutions

EXOSC3 antibody - C-terminal region (ARP40230_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP40230_P050-FITC Conjugated

ARP40230_P050-HRP Conjugated

ARP40230_P050-Biotin Conjugated

Gene Symbol:
NCBI Gene Id:
Official Gene Full Name:
Exosome component 3
Protein Name:
Exosome complex component RRP40
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
CGI-102, MGC15120, MGC723, RP11-3J10.8, RRP40, Rrp40p, bA3J10.7, hRrp40p, p10, hRrp-40
Replacement Item:
This antibody may replace item sc-107210 from Santa Cruz Biotechnology.
Description of Target:
EXOSC3 is component of the exosome 3'->5' exoribonuclease complex and is required for the 3' processing of the 7S pre-RNA to the mature 5.8S rRNA.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express EXOSC3.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express EXOSC3.
The immunogen is a synthetic peptide directed towards the C terminal region of human EXOSC3
Tested Species Reactivity:
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 91%; Zebrafish: 100%
Complete computational species homology data:
Anti-EXOSC3 (ARP40230_P050)
Peptide Sequence:
Synthetic peptide located within the following region: VIGIVTAKSGDIFKVDVGGSEPASLSYLSFEGATKRNRPNVQAISSRL
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-EXOSC3 (ARP40230_P050) antibody is Catalog # AAP40230 (Previous Catalog # AAPP22074)
Printable datasheet for anti-EXOSC3 (ARP40230_P050) antibody
Target Reference:
Lehner,B. (2004) Genome Res. 14 (7), 1315-1323

Fan, M.-J. et al. Reduction of TLR4 mRNA stability and protein expressions through inhibiting cytoplasmic translocation of HuR transcription factor by E₂ and/or ER-alpha in LPS-treated H9c2 cardiomyoblast cells. Chin. J. Physiol. 57, 8-18 (2014). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish 24621334

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...