Size:100 ul
Special Price $229.00 Regular Price $289.00
In stock
SKU
ARP40230_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP40230_P050-FITC Conjugated

ARP40230_P050-HRP Conjugated

ARP40230_P050-Biotin Conjugated

EXOSC3 Antibody - C-terminal region (ARP40230_P050)

Catalog#: ARP40230_P050
Domestic: within 1-2 days delivery International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-107210 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human EXOSC3
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 91%; Zebrafish: 100%
Complete computational species homology data Anti-EXOSC3 (ARP40230_P050)
Peptide Sequence Synthetic peptide located within the following region: VIGIVTAKSGDIFKVDVGGSEPASLSYLSFEGATKRNRPNVQAISSRL
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-EXOSC3 (ARP40230_P050) antibody is Catalog # AAP40230 (Previous Catalog # AAPP22074)
Datasheets/Manuals Printable datasheet for anti-EXOSC3 (ARP40230_P050) antibody
Target Reference Lehner,B. (2004) Genome Res. 14 (7), 1315-1323
Publications

Fan, M.-J. et al. Reduction of TLR4 mRNA stability and protein expressions through inhibiting cytoplasmic translocation of HuR transcription factor by Eâ‚‚ and/or ER-alpha in LPS-treated H9c2 cardiomyoblast cells. Chin. J. Physiol. 57, 8-18 (2014). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish 24621334

Gene Symbol EXOSC3
Official Gene Full Name Exosome component 3
Alias Symbols CGI-102, MGC15120, MGC723, RP11-3J10.8, RRP40, Rrp40p, bA3J10.7, hRrp40p, p10, hRrp-40
NCBI Gene Id 51010
Protein Name Exosome complex component RRP40
Description of Target EXOSC3 is component of the exosome 3'->5' exoribonuclease complex and is required for the 3' processing of the 7S pre-RNA to the mature 5.8S rRNA.
Swissprot Id Q9NQT5
Protein Accession # NP_001002269
Nucleotide Accession # NM_001002269
Protein Size (# AA) 164
Molecular Weight 17kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express EXOSC3.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express EXOSC3.
Protein Interactions UBC; EXOSC5; EXOSC4; CDK5RAP1; EXOSC8; ATP5D; AICDA; EXOSC10; EXOSC9; APP; EXOSC2; EXOSC6; DIS3L; EXOSC1; EXOSC3; EXOSC7; DIS3; MPHOSPH6; HDGF; KHSRP;
Write Your Own Review
You're reviewing:EXOSC3 Antibody - C-terminal region (ARP40230_P050)
Your Rating