EXOC3 Antibody - middle region : Biotin (ARP52317_P050-Biotin)

Catalog No: ARP52317_P050-Biotin

Size:100ul

Product Info

• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
• Clonality: Polyclonal
• Host: Rabbit
• Conjugation: Biotin
• Application: IHC, WB
• Reconstitution and Storage: All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human EXOC3
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 79%
• Peptide Sequence: Synthetic peptide located within the following region: LERTVTTRIEGTQADTRESDKMWLVRHLEIIRKYVLDDLIVAKNLMVQCF
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-EXOC3 (ARP52317_P050-Biotin) antibody is Catalog # AAP52317 (Previous Catalog # AAPP34705)
• Sample Type Confirmation:

  EXOC3 is supported by BioGPS gene expression data to be expressed in HeLa

• Reference: Hsu,S.C., Int. Rev. Cytol. 233, 243-265 (2004)

Target Info

• Gene Symbol: EXOC3
• Gene Full Name: Exocyst complex component 3
• Alias Symbols: SEC6, Sec6p, SEC6L1
• NCBI Gene Id: 11336
• Protein Name: Epididymis secretory sperm binding protein Li 19lP EMBL ADU87645.1
• Description of Target: EXOC3 is a component of the exocyst complex, a multiple protein complex essential for targeting exocytic vesicles to specific docking sites on the plasma membrane. Though best characterized in yeast, the component proteins and functions of exocyst complex have been demonstrated to be highly conserved in higher eukaryotes. At least eight components of the exocyst complex, including this protein, are found to interact with the actin cytoskeletal remodeling and vesicle transport machinery. The complex is also essential for the biogenesis of epithelial cell surface polarity.The protein encoded by this gene is a component of the exocyst complex, a multiple protein complex essential for targeting exocytic vesicles to specific docking sites on the plasma membrane. Though best characterized in yeast, the component proteins and functions of exocyst complex have been demonstrated to be highly conserved in higher eukaryotes. At least eight components of the exocyst complex, including this protein, are found to interact with the actin cytoskeletal remodeling and vesicle transport machinery. The complex is also essential for the biogenesis of epithelial cell surface polarity.
• Uniprot ID: Q6P2E8
• Protein Accession #: NP_009208
• Nucleotide Accession #: NM_007277
• Protein Size (# AA): 745
• Molecular Weight: 85kDa
• Protein Interactions: UBC; INPP5K; PRPF19; KIAA0907; EGFR; EXOC4; BUB3; MLH1; EXOC8; EXOC2; EXOC6; EXOC5; APP; MYO5A; Poc1b; RALA; GRIN2B; DLG3;