Now Offering Over 102,157 Antibodies & 44,722 Antigens!

EXOC3 antibody - middle region (ARP52317_P050)

100 ul
$289.00
In Stock

Conjugation Options

ARP52317_P050-FITC Conjugated

ARP52317_P050-HRP Conjugated

ARP52317_P050-Biotin Conjugated

Gene Symbol:
EXOC3
NCBI Gene Id:
11336
Official Gene Full Name:
Exocyst complex component 3
Protein Name:
Epididymis secretory sperm binding protein Li 19lP EMBL ADU87645.1
Swissprot Id:
Q6P2E8
Protein Accession #:
NP_009208
Nucleotide Accession #:
NM_007277
Alias Symbols:
SEC6, SEC6L1, Sec6p
Replacement Item:
This antibody may replace item sc-106816 from Santa Cruz Biotechnology.
Description of Target:
EXOC3 is a component of the exocyst complex, a multiple protein complex essential for targeting exocytic vesicles to specific docking sites on the plasma membrane. Though best characterized in yeast, the component proteins and functions of exocyst complex have been demonstrated to be highly conserved in higher eukaryotes. At least eight components of the exocyst complex, including this protein, are found to interact with the actin cytoskeletal remodeling and vesicle transport machinery. The complex is also essential for the biogenesis of epithelial cell surface polarity.The protein encoded by this gene is a component of the exocyst complex, a multiple protein complex essential for targeting exocytic vesicles to specific docking sites on the plasma membrane. Though best characterized in yeast, the component proteins and functions of exocyst complex have been demonstrated to be highly conserved in higher eukaryotes. At least eight components of the exocyst complex, including this protein, are found to interact with the actin cytoskeletal remodeling and vesicle transport machinery. The complex is also essential for the biogenesis of epithelial cell surface polarity.
Protein Size (# AA):
745
Molecular Weight:
85kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
IHC, WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express EXOC3.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express EXOC3.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human EXOC3
Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 79%
Complete computational species homology data:
Anti-EXOC3 (ARP52317_P050)
Peptide Sequence:
Synthetic peptide located within the following region: LERTVTTRIEGTQADTRESDKMWLVRHLEIIRKYVLDDLIVAKNLMVQCF
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
UBC; INPP5K; PRPF19; KIAA0907; EGFR; EXOC4; BUB3; MLH1; EXOC8; EXOC2; EXOC6; EXOC5; APP; MYO5A; Poc1b; RALA; GRIN2B; DLG3;
Blocking Peptide:
For anti-EXOC3 (ARP52317_P050) antibody is Catalog # AAP52317 (Previous Catalog # AAPP34705)
Datasheets/Manuals:
Printable datasheet for anti-EXOC3 (ARP52317_P050) antibody
Sample Type Confirmation:

EXOC3 is supported by BioGPS gene expression data to be expressed in HeLa

Target Reference:
Hsu,S.C., Int. Rev. Cytol. 233, 243-265 (2004)

Tell us what you think about this item!

Write A Review
    Please, wait...