EWSR1 Antibody - middle region (ARP38594_P050)

Catalog No: ARP38594_P050

WB Suggested Anti-EWSR1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Jurkat cell lysate.EWSR1 is strongly supported by BioGPS gene expression data to be expressed in Jurkat

Lanes:
Lane 1: 50ug Hela Lysate
Primary Antibody Dilution:
1:1000
Secondary Antibody:
Anti-rabbit-HRP
Secondary Antibody Dilution:
1:10,000
Gene Name:
EWSR1
Submitted by:
Archa Fox, University of Western Australia
EWSR1 is strongly supported by BioGPS gene expression data to be expressed in Human HeLa cells

Rabbit Anti-EWSR1 Antibody
Catalog Number: ARP38594_P050
Formalin Fixed Paraffin Embedded Tissue: Human heart Tissue
Observed Staining: Cytoplasmic, plasma membrane
Primary Antibody Concentration: 1:100
Other Working Concentrations: 1:600
Secondary Antibody: Donkey anti-Rabbit-Cy3
Secondary Antibody Concentration: 1:200
Magnification: 20X
Exposure Time: 0.5 - 2.0 sec

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB, IHC
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human EWSR1
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 77%
• Peptide Sequence: Synthetic peptide located within the following region: RGGFGGGRRGGPGGPPGPLMEQMGGRRGGRGGPGKMDKGEHRQERRDRPY
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-EWSR1 (ARP38594_P050) antibody is Catalog # AAP38594 (Previous Catalog # AAPS04410)
• Sample Type Confirmation:

  EWSR1 is strongly supported by BioGPS gene expression data to be expressed in HeLa, Jurkat

• Reference: Brandal,P., (2008) Genes Chromosomes Cancer 47 (7), 558-564

Target Info

• Gene Symbol: EWSR1
• Gene Full Name: Ewing sarcoma breakpoint region 1
• Alias Symbols: EWS, EWS-FLI1, bK984G1.4
• NCBI Gene Id: 2130
• Protein Name: RNA-binding protein EWS
• Description of Target: EWSR1 is a putative RNA binding protein. Mutations in this gene, specifically a t(11;22)(q24;q12) translocation, are known to cause Ewing sarcoma as well as neuroectodermal and various other tumors. Alternative splicing of this gene results in two products.This gene encodes a putative RNA binding protein. Mutations in this gene, specifically a t(11;22)(q24;q12) translocation, are known to cause Ewing sarcoma as well as neuroectodermal and various other tumors. Alternative splicing of this gene results in two products.
• Uniprot ID: Q01844
• Protein Accession #: NP_005234
• Nucleotide Accession #: NM_005243
• Protein Size (# AA): 656
• Molecular Weight: 68kDa
• Protein Interactions: SSBP3; SEC24A; TFG; SEC24D; PEF1; MAPK1IP1L; ATPAF2; TRAF2; TRAF1; PLSCR1; PRR13; UBC; RPA3; RPA2; RPA1; EZH2; SUZ12; RNF2; BMI1; rev; ITCH; WBP4; PRMT1; CCDC7; YY1AP1; MRPS18B; UBD; CD81; RIOK2; NONO; ITGB5; ITGA4; FUS; FN1; EWSR1; EPAS1; EP300; HNRNPUL1