Catalog No: P100807_P050-Biotin
Size:100ul
Price: $434.00
SKU
P100807_P050-Biotin
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.

ETV6 Antibody - C-terminal region : Biotin (P100807_P050-Biotin)

Click here to learn more about Aviva's By-Request Conjugation Service.
Datasheets/ManualsPrintable datasheet for anti-ETV6 (P100807_P050-Biotin) antibody
Product Info
ReferenceSchick,N., et al., (2004) J.Biol.Chem.279(37),38787-38796
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer.
ClonalityPolyclonal
HostRabbit
ConjugationBiotin
ApplicationIHC, WB
Reconstitution and StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
ImmunogenThe immunogen is a synthetic peptide directed towards the C terminal region of human ETV6
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 92%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 92%
Peptide SequenceSynthetic peptide located within the following region: VSVSPPEEHAMPIGRIADCRLLWDYVYQLLSDSRYENFIRWEDKESKIFR
Concentration0.5 mg/ml
Blocking PeptideFor anti-ETV6 (P100807_P050-Biotin) antibody is Catalog # AAP31149 (Previous Catalog # AAPS19405)
Gene SymbolETV6
Gene Full NameEts variant 6
Alias SymbolsTEL, THC5, TEL/ABL
NCBI Gene Id2120
Protein NameTranscription factor ETV6
Description of TargetETV6 (ETS-related protein Tel1, ETS translocation variant 6 , Tel) is an ETS family transcription factor. This protein contains two functional domains: a N-terminal pointed (PNT) domain that is involved in the protein-protein interactions with itself and other proteins, and a C-terminal DNA-binding domain. Gene knockout studies in mice suggest that it is required for hematopoiesis and maintenance of the developing vascular network. This gene is known to be involved in a large number of chromosomal rearrangements associated with leukemia and congenital fibrosarcoma.This gene encodes an ETS family transcription factor. The product of this gene contains two functional domains: a N-terminal pointed (PNT) domain that is involved in the protein-protein interactions with itself and other proteins, and a C-terminal DNA-binding domain. Gene knockout studies in mice suggest that it is required for hematopoiesis and maintenance of the developing vascular network. This gene is known to be involved in a large number of chromosomal rearrangements associated with leukemia and congenital fibrosarcoma. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Uniprot IDP41212
Protein Accession #NP_001978
Nucleotide Accession #NM_001987
Protein Size (# AA)452
Molecular Weight53kDa
Protein InteractionsAP1M1; WDYHV1; UBC; SUMO1; NEDD8; ETV6; SUMO2; PIN1; HDAC6; SOX2; TRAF3; SOCS3; SOCS1; PDGFRB; ELAVL1; UBE2I; NCOR1; SIN3A; HDAC3; L3MBTL1; SMURF1; HDAC9; KAT5; FLI1; IRF8; SKP1; FBXL6; GAB2; GRB2; CRKL; ACTA1;
  1. What is the species homology for "ETV6 Antibody - C-terminal region : Biotin (P100807_P050-Biotin)"?

    The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish".

  2. How long will it take to receive "ETV6 Antibody - C-terminal region : Biotin (P100807_P050-Biotin)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "ETV6 Antibody - C-terminal region : Biotin (P100807_P050-Biotin)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "ETV6 Antibody - C-terminal region : Biotin (P100807_P050-Biotin)"?

    This target may also be called "TEL, THC5, TEL/ABL" in publications.

  5. What is the shipping cost for "ETV6 Antibody - C-terminal region : Biotin (P100807_P050-Biotin)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "ETV6 Antibody - C-terminal region : Biotin (P100807_P050-Biotin)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "ETV6 Antibody - C-terminal region : Biotin (P100807_P050-Biotin)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "53kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "ETV6 Antibody - C-terminal region : Biotin (P100807_P050-Biotin)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "ETV6"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "ETV6"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "ETV6"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "ETV6"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "ETV6"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "ETV6"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:ETV6 Antibody - C-terminal region : Biotin (P100807_P050-Biotin)
Your Rating
We found other products you might like!