Size:100 ul
$319.00
In Stock
SKU
ARP32263_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP32263_P050-FITC Conjugated

ARP32263_P050-HRP Conjugated

ARP32263_P050-Biotin Conjugated

ETV4 Antibody - middle region (ARP32263_P050)

Catalog#: ARP32263_P050
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-113 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human ETV4
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 86%; Horse: 93%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 93%; Rat: 100%
Complete computational species homology data Anti-ETV4 (ARP32263_P050)
Peptide Sequence Synthetic peptide located within the following region: HSSVFQQPLDICHSFTSQGGGREPLPAPYQHQLSEPCPPYPQQSFKQEYH
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-ETV4 (ARP32263_P050) antibody is Catalog # AAP32263 (Previous Catalog # AAPP03244)
Datasheets/Manuals Printable datasheet for anti-ETV4 (ARP32263_P050) antibody
Target Reference Span,P.N., et al., (2003) Breast Cancer Res. Treat. 79 (1), 129-131
Publications

Hollenhorst, P. C. et al. Oncogenic ETS proteins mimic activated RAS/MAPK signaling in prostate cells. Genes Dev. 25, 2147-57 (2011). WB, Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat 22012618

Hollenhorst, P. C., Paul, L., Ferris, M. W. & Graves, B. J. The ETS gene ETV4 is required for anchorage-independent growth and a cell proliferation gene expression program in PC3 prostate cells. Genes Cancer 1, 1044-1052 (2011). WB, Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat 21373373

Kedage, V; Selvaraj, N; Nicholas, TR; Budka, JA; Plotnik, JP; Jerde, TJ; Hollenhorst, PC; An Interaction with Ewing's Sarcoma Breakpoint Protein EWS Defines a Specific Oncogenic Mechanism of ETS Factors Rearranged in Prostate Cancer. 17, 1289-1301 (2016). WB, Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat 27783944

Okimoto, RA; Breitenbuecher, F; Olivas, VR; Wu, W; Gini, B; Hofree, M; Asthana, S; Hrustanovic, G; Flanagan, J; Tulpule, A; Blakely, CM; Haringsma, HJ; Simmons, AD; Gowen, K; Suh, J; Miller, VA; Ali, S; Schuler, M; Bivona, TG; Inactivation of Capicua drives cancer metastasis. 49, 87-96 (2017). WB, Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat 27869830

Selvaraj, N., Budka, J. A., Ferris, M. W., Jerde, T. J. & Hollenhorst, P. C. Prostate cancer ETS rearrangements switch a cell migration gene expression program from RAS/ERK to PI3K/AKT regulation. Mol. Cancer 13, 61 (2014). WB, Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat 24642271

Gene Symbol ETV4
Official Gene Full Name Ets variant 4
Alias Symbols E1A-F, E1AF, PEA3, PEAS3
NCBI Gene Id 2118
Protein Name ETS translocation variant 4
Description of Target The protein encoded by the ETV4 gene is known to play a role in ovarian and breast malignancies as well as in the early stage of colorectal carcinogenesis.
Swissprot Id P43268
Protein Accession # NP_001977
Nucleotide Accession # NM_001986
Protein Size (# AA) 484
Molecular Weight 54kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express ETV4.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express ETV4.
Protein Interactions STK11; RFWD2; TP63; ATXN1; HTT; APP; UBC; SMAD2; SUMO2; SUMO1; SAE1; UBA2; HOXD4; EP300; SRF;
  1. What is the species homology for "ETV4 Antibody - middle region (ARP32263_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat".

  2. How long will it take to receive "ETV4 Antibody - middle region (ARP32263_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "ETV4 Antibody - middle region (ARP32263_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "ETV4 Antibody - middle region (ARP32263_P050)"?

    This target may also be called "E1A-F, E1AF, PEA3, PEAS3" in publications.

  5. What is the shipping cost for "ETV4 Antibody - middle region (ARP32263_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "ETV4 Antibody - middle region (ARP32263_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "ETV4 Antibody - middle region (ARP32263_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "54kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "ETV4 Antibody - middle region (ARP32263_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "ETV4"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "ETV4"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "ETV4"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "ETV4"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "ETV4"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "ETV4"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:ETV4 Antibody - middle region (ARP32263_P050)
Your Rating
We found other products you might like!