Size:100 ul
$319.00
In stock
SKU
ARP32263_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP32263_P050-FITC Conjugated

ARP32263_P050-HRP Conjugated

ARP32263_P050-Biotin Conjugated

ETV4 Antibody - middle region (ARP32263_P050)

Catalog#: ARP32263_P050
Domestic: within 1-2 days delivery International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-113 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human ETV4
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 86%; Horse: 93%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 93%; Rat: 100%
Complete computational species homology data Anti-ETV4 (ARP32263_P050)
Peptide Sequence Synthetic peptide located within the following region: HSSVFQQPLDICHSFTSQGGGREPLPAPYQHQLSEPCPPYPQQSFKQEYH
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-ETV4 (ARP32263_P050) antibody is Catalog # AAP32263 (Previous Catalog # AAPP03244)
Datasheets/Manuals Printable datasheet for anti-ETV4 (ARP32263_P050) antibody
Target Reference Span,P.N., et al., (2003) Breast Cancer Res. Treat. 79 (1), 129-131
Publications

Hollenhorst, P. C. et al. Oncogenic ETS proteins mimic activated RAS/MAPK signaling in prostate cells. Genes Dev. 25, 2147-57 (2011). WB, Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat 22012618

Hollenhorst, P. C., Paul, L., Ferris, M. W. & Graves, B. J. The ETS gene ETV4 is required for anchorage-independent growth and a cell proliferation gene expression program in PC3 prostate cells. Genes Cancer 1, 1044-1052 (2011). WB, Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat 21373373

Kedage, V; Selvaraj, N; Nicholas, TR; Budka, JA; Plotnik, JP; Jerde, TJ; Hollenhorst, PC; An Interaction with Ewing's Sarcoma Breakpoint Protein EWS Defines a Specific Oncogenic Mechanism of ETS Factors Rearranged in Prostate Cancer. 17, 1289-1301 (2016). WB, Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat 27783944

Okimoto, RA; Breitenbuecher, F; Olivas, VR; Wu, W; Gini, B; Hofree, M; Asthana, S; Hrustanovic, G; Flanagan, J; Tulpule, A; Blakely, CM; Haringsma, HJ; Simmons, AD; Gowen, K; Suh, J; Miller, VA; Ali, S; Schuler, M; Bivona, TG; Inactivation of Capicua drives cancer metastasis. 49, 87-96 (2017). WB, Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat 27869830

Selvaraj, N., Budka, J. A., Ferris, M. W., Jerde, T. J. & Hollenhorst, P. C. Prostate cancer ETS rearrangements switch a cell migration gene expression program from RAS/ERK to PI3K/AKT regulation. Mol. Cancer 13, 61 (2014). WB, Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat 24642271

Gene Symbol ETV4
Official Gene Full Name Ets variant 4
Alias Symbols E1A-F, E1AF, PEA3, PEAS3
NCBI Gene Id 2118
Protein Name ETS translocation variant 4
Description of Target The protein encoded by the ETV4 gene is known to play a role in ovarian and breast malignancies as well as in the early stage of colorectal carcinogenesis.
Swissprot Id P43268
Protein Accession # NP_001977
Nucleotide Accession # NM_001986
Protein Size (# AA) 484
Molecular Weight 54kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express ETV4.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express ETV4.
Protein Interactions STK11; RFWD2; TP63; ATXN1; HTT; APP; UBC; SMAD2; SUMO2; SUMO1; SAE1; UBA2; HOXD4; EP300; SRF;
Write Your Own Review
You're reviewing:ETV4 Antibody - middle region (ARP32263_P050)
Your Rating