Aviva Systems Biology office will be closed for Memorial Day - May 27, 2019.
Please go here for more info.

Search Antibody, Protein, and ELISA Kit Solutions

ETV4 Antibody - middle region (ARP32263_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP32263_P050-FITC Conjugated

ARP32263_P050-HRP Conjugated

ARP32263_P050-Biotin Conjugated

Gene Symbol:
Official Gene Full Name:
Ets variant 4
NCBI Gene Id:
Protein Name:
ETS translocation variant 4
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Replacement Item:
This antibody may replace item sc-113 from Santa Cruz Biotechnology.
Description of Target:
The protein encoded by the ETV4 gene is known to play a role in ovarian and breast malignancies as well as in the early stage of colorectal carcinogenesis.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express ETV4.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express ETV4.
The immunogen is a synthetic peptide directed towards the middle region of human ETV4
Predicted Species Reactivity:
Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat
Tested Species Reactivity:
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 86%; Horse: 93%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 93%; Rat: 100%
Complete computational species homology data:
Anti-ETV4 (ARP32263_P050)
Peptide Sequence:
Synthetic peptide located within the following region: HSSVFQQPLDICHSFTSQGGGREPLPAPYQHQLSEPCPPYPQQSFKQEYH
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-ETV4 (ARP32263_P050) antibody is Catalog # AAP32263 (Previous Catalog # AAPP03244)
Printable datasheet for anti-ETV4 (ARP32263_P050) antibody
Target Reference:
Span,P.N., et al., (2003) Breast Cancer Res. Treat. 79 (1), 129-131

Hollenhorst, P. C. et al. Oncogenic ETS proteins mimic activated RAS/MAPK signaling in prostate cells. Genes Dev. 25, 2147-57 (2011). WB, Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat 22012618

Hollenhorst, P. C., Paul, L., Ferris, M. W. & Graves, B. J. The ETS gene ETV4 is required for anchorage-independent growth and a cell proliferation gene expression program in PC3 prostate cells. Genes Cancer 1, 1044-1052 (2011). WB, Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat 21373373

Kedage, V; Selvaraj, N; Nicholas, TR; Budka, JA; Plotnik, JP; Jerde, TJ; Hollenhorst, PC; An Interaction with Ewing's Sarcoma Breakpoint Protein EWS Defines a Specific Oncogenic Mechanism of ETS Factors Rearranged in Prostate Cancer. 17, 1289-1301 (2016). WB, Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat 27783944

Okimoto, RA; Breitenbuecher, F; Olivas, VR; Wu, W; Gini, B; Hofree, M; Asthana, S; Hrustanovic, G; Flanagan, J; Tulpule, A; Blakely, CM; Haringsma, HJ; Simmons, AD; Gowen, K; Suh, J; Miller, VA; Ali, S; Schuler, M; Bivona, TG; Inactivation of Capicua drives cancer metastasis. 49, 87-96 (2017). WB, Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat 27869830

Selvaraj, N., Budka, J. A., Ferris, M. W., Jerde, T. J. & Hollenhorst, P. C. Prostate cancer ETS rearrangements switch a cell migration gene expression program from RAS/ERK to PI3K/AKT regulation. Mol. Cancer 13, 61 (2014). WB, Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat 24642271

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...