ETV4 Antibody - middle region (ARP32263_P050)

Catalog No: ARP32263_P050

WB Suggested Anti-ETV4 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human Small Intestine

Host: Rabbit
Target Name: ETV4
Sample Tissue: Human Jurkat Whole Cell
Antibody Dilution: 1ug/ml

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ETV4
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 86%; Horse: 93%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 93%; Rat: 100%
• Peptide Sequence: Synthetic peptide located within the following region: HSSVFQQPLDICHSFTSQGGGREPLPAPYQHQLSEPCPPYPQQSFKQEYH
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-ETV4 (ARP32263_P050) antibody is Catalog # AAP32263 (Previous Catalog # AAPP03244)
• Reference: Span,P.N., et al., (2003) Breast Cancer Res. Treat. 79 (1), 129-131
• Publications:

  An Interaction with Ewing's Sarcoma Breakpoint Protein EWS Defines a Specific Oncogenic Mechanism of ETS Factors Rearranged in Prostate Cancer. Cell Rep. 17, 1289-1301 (2016). 27783944

  Capicua regulates neural stem cell proliferation and lineage specification through control of Ets factors. Nat Commun. 10, 2000 (2019). 31043608

  Dynamics of chromatin accessibility during TGF-β-induced EMT of Ras-transformed mammary gland epithelial cells. Sci Rep. 7, 1166 (2017). 28446749

  ETV4 Is Necessary for Estrogen Signaling and Growth in Endometrial Cancer Cells. Cancer Res. 80, 1234-1245 (2020). 32046982

  Hollenhorst, P. C. et al. Oncogenic ETS proteins mimic activated RAS/MAPK signaling in prostate cells. Genes Dev. 25, 2147-57 (2011). 22012618

  Hollenhorst, P. C., Paul, L., Ferris, M. W. & Graves, B. J. The ETS gene ETV4 is required for anchorage-independent growth and a cell proliferation gene expression program in PC3 prostate cells. Genes Cancer 1, 1044-1052 (2011). 21373373

  Inactivation of Capicua drives cancer metastasis. Nat. Genet. 49, 87-96 (2017). 27869830

  Interaction of BRAF-induced ETS factors with mutant TERT promoter in papillary thyroid cancer. Endocr Relat Cancer. 26, 629-641 (2019). 30999281

  ME1 Regulates NADPH Homeostasis to Promote Gastric Cancer Growth and Metastasis. Cancer Res. 78, 1972-1985 (2018). 29654155

  Selvaraj, N., Budka, J. A., Ferris, M. W., Jerde, T. J. & Hollenhorst, P. C. Prostate cancer ETS rearrangements switch a cell migration gene expression program from RAS/ERK to PI3K/AKT regulation. Mol. Cancer 13, 61 (2014). 24642271

Target Info

• Gene Symbol: ETV4
• Gene Full Name: Ets variant 4
• Alias Symbols: E1AF, PEA3, E1A-F, PEAS3
• NCBI Gene Id: 2118
• Protein Name: ETS translocation variant 4
• Description of Target: The protein encoded by the ETV4 gene is known to play a role in ovarian and breast malignancies as well as in the early stage of colorectal carcinogenesis.
• Uniprot ID: P43268
• Protein Accession #: NP_001977
• Nucleotide Accession #: NM_001986
• Protein Size (# AA): 484
• Molecular Weight: 54kDa
• Protein Interactions: STK11; RFWD2; TP63; ATXN1; HTT; APP; UBC; SMAD2; SUMO2; SUMO1; SAE1; UBA2; HOXD4; EP300; SRF;