Aviva Systems Biology office will be closed for Good Friday - April 19, 2019.
Please go here for more info.

Search Antibody, Protein, and ELISA Kit Solutions

ETS2 Antibody - C-terminal region (P100751_P050)

  • Catalog#: P100751_P050
  • Inquire
Click here to learn more about Aviva's By-Request Conjugation Service.
100 ul
$289.00
Discontinued
Request Bulk Order Quote

Conjugation Options

P100751_P050-FITC Conjugated

P100751_P050-HRP Conjugated

P100751_P050-Biotin Conjugated

Click here to learn more about Aviva's By-Request Conjugation Service.
Gene Symbol:
ETS2
Official Gene Full Name:
V-ets erythroblastosis virus E26 oncogene homolog 2 (avian)
NCBI Gene Id:
2114
Protein Name:
Protein C-ets-2
Swissprot Id:
P15036
Protein Accession #:
NP_005230
Nucleotide Accession #:
NM_005239
Alias Symbols:
ETS2IT1
Description of Target:
ETS2 contains an ETS DNA-binding domain and belongs to the ETS family. ETS2 is a target of protein kinase C and upregulates GM-CSF. Ets2 and its targets play essential roles in endothelial cell function. Coexpression of Ets-2 and SRC-1 significantly associated with the rate of recurrence and HER expression in breast cancer. Overexpression of ETS2 is associated with human esophageal squamous cell carcinoma. ETS transcriptions factors, such as ETS2, regulate numerous genes and are involved in stem cell development, cell senescence and death, and tumorigenesis. The conserved ETS domain within these proteins is a winged helix-turn-helix DNA-binding domain that recognizes the core consensus DNA sequence GGAA/T of target genes (Dwyer et al., 2007 [PubMed 17986575]).[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Protein Size (# AA):
469
Molecular Weight:
53kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
IHC, WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express ETS2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express ETS2.
Immunogen:
The immunogen is a synthetic peptide directed towards the C terminal region of human ETS2
Predicted Species Reactivity:
Cow, Dog, Human, Mouse, Rat, Sheep
Tested Species Reactivity:
Human
Predicted Homology Based on Immunogen Sequence:
Cow: 92%; Dog: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Sheep: 92%
Complete computational species homology data:
Anti-ETS2 (P100751_P050)
Peptide Sequence:
Synthetic peptide located within the following region: FESFEDDCSQSLCLNKPTMSFKDYIQERSDPVEQGKPVIPAAVLAGFTGS
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
UBC; RFWD2; TWIST1; POU5F1; TWIST2; ZFYVE9; SRA1; XPO1; TP53; SUMO2; EP300; CREBBP; NCOR1; NCOA3; SRC; ZMYND11; TDP2; STAT5B; CDK10; SMARCA4; JUN; ERG; ETS2; ETS1; NR3C1; GATA3; FOS; SPI1; BRCA1;
Blocking Peptide:
For anti-ETS2 (P100751_P050) antibody is Catalog # AAP31071 (Previous Catalog # AAPP01809)
Datasheets/Manuals:
Printable datasheet for anti-ETS2 (P100751_P050) antibody
Additional Information:
IHC Information: Paraffin embedded breast tissue, tested with an antibody dilution of 5 ug/ml.
Target Reference:
Geng,C.D. (2005) J. Biol. Chem. 280 (52), 43264-43271/ Yoshimatsu, Y. (2011) J. Cell. Sci. 124, 2753-2762
Publications:

Yang, H; Schramek, D; Adam, RC; Keyes, BE; Wang, P; Zheng, D; Fuchs, E; ETS family transcriptional regulators drive chromatin dynamics and malignancy in squamous cell carcinomas. 4, e10870 (2015). IHC, WB, Cow, Dog, Human, Mouse, Rat, Sheep 26590320

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...