Size:100 ul
Special Price $229.00 Regular Price $289.00
In stock
SKU
P100751_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

P100751_P050-FITC Conjugated

P100751_P050-HRP Conjugated

P100751_P050-Biotin Conjugated

ETS2 Antibody - C-terminal region (P100751_P050)

Catalog#: P100751_P050
Inquire
Click here to learn more about Aviva's By-Request Conjugation Service.
More Information
Tested Species ReactivityHuman
Predicted Species ReactivityCow, Dog, Human, Mouse, Rat, Sheep
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationIHC, WB
Additional InformationIHC Information: Paraffin embedded breast tissue, tested with an antibody dilution of 5 ug/ml.
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the C terminal region of human ETS2
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 92%; Dog: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Sheep: 92%
Complete computational species homology dataAnti-ETS2 (P100751_P050)
Peptide SequenceSynthetic peptide located within the following region: FESFEDDCSQSLCLNKPTMSFKDYIQERSDPVEQGKPVIPAAVLAGFTGS
ConcentrationBatch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking PeptideFor anti-ETS2 (P100751_P050) antibody is Catalog # AAP31071 (Previous Catalog # AAPP01809)
Datasheets/ManualsPrintable datasheet for anti-ETS2 (P100751_P050) antibody
Target ReferenceGeng,C.D. (2005) J. Biol. Chem. 280 (52), 43264-43271/ Yoshimatsu, Y. (2011) J. Cell. Sci. 124, 2753-2762
Publications

Yang, H; Schramek, D; Adam, RC; Keyes, BE; Wang, P; Zheng, D; Fuchs, E; ETS family transcriptional regulators drive chromatin dynamics and malignancy in squamous cell carcinomas. 4, e10870 (2015). IHC, WB, Cow, Dog, Human, Mouse, Rat, Sheep 26590320

Gene SymbolETS2
Official Gene Full NameV-ets erythroblastosis virus E26 oncogene homolog 2 (avian)
Alias SymbolsETS2IT1
NCBI Gene Id2114
Protein NameProtein C-ets-2
Description of TargetETS2 contains an ETS DNA-binding domain and belongs to the ETS family. ETS2 is a target of protein kinase C and upregulates GM-CSF. Ets2 and its targets play essential roles in endothelial cell function. Coexpression of Ets-2 and SRC-1 significantly associated with the rate of recurrence and HER expression in breast cancer. Overexpression of ETS2 is associated with human esophageal squamous cell carcinoma. ETS transcriptions factors, such as ETS2, regulate numerous genes and are involved in stem cell development, cell senescence and death, and tumorigenesis. The conserved ETS domain within these proteins is a winged helix-turn-helix DNA-binding domain that recognizes the core consensus DNA sequence GGAA/T of target genes (Dwyer et al., 2007 [PubMed 17986575]).[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Swissprot IdP15036
Protein Accession #NP_005230
Nucleotide Accession #NM_005239
Protein Size (# AA)469
Molecular Weight53kDa
Tissue ToolFind tissues and cell lines supported by DNA array analysis to express ETS2.
RNA SeqFind tissues and cell lines supported by RNA-seq analysis to express ETS2.
Protein InteractionsUBC; RFWD2; TWIST1; POU5F1; TWIST2; ZFYVE9; SRA1; XPO1; TP53; SUMO2; EP300; CREBBP; NCOR1; NCOA3; SRC; ZMYND11; TDP2; STAT5B; CDK10; SMARCA4; JUN; ERG; ETS2; ETS1; NR3C1; GATA3; FOS; SPI1; BRCA1;
Write Your Own Review
You're reviewing:ETS2 Antibody - C-terminal region (P100751_P050)
Your Rating
Free Microscope
Aviva Blast Tool
Assay Development
Aviva HIS tag Deal