Size:100 ul
$289.00
Discontinued
SKU
P100751_P050-Biotin
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

P100751_P050 Unconjugated

P100751_P050-FITC Conjugated

P100751_P050-HRP Conjugated

ETS2 Antibody - C-terminal region : Biotin (P100751_P050-Biotin)

Catalog#: P100751_P050-Biotin
Inquire
Click here to learn more about Aviva's By-Request Conjugation Service.
More Information
Predicted Species Reactivity Cow, Dog, Human, Mouse, Rat, Sheep
Product Format Liquid. Purified antibody supplied in 1x PBS buffer.
Clonality Polyclonal
Host Rabbit
Conjugation Biotin
Application IHC, WB
Additional Information IHC Information: Paraffin embedded breast tissue, tested with an antibody dilution of 5 ug/ml.
Reconstitution and Storage All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human ETS2
Predicted Homology Based on Immunogen Sequence Cow: 92%; Dog: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Sheep: 92%
Complete computational species homology data Anti-ETS2 (P100751_P050)
Peptide Sequence Synthetic peptide located within the following region: FESFEDDCSQSLCLNKPTMSFKDYIQERSDPVEQGKPVIPAAVLAGFTGS
Concentration 0.5 mg/ml
Blocking Peptide For anti-ETS2 (P100751_P050-Biotin) antibody is Catalog # AAP31071 (Previous Catalog # AAPP01809)
Datasheets/Manuals Printable datasheet for anti-ETS2 (P100751_P050-Biotin) antibody
Target Reference Geng,C.D. (2005) J. Biol. Chem. 280 (52), 43264-43271/ Yoshimatsu, Y. (2011) J. Cell. Sci. 124, 2753-2762
Gene Symbol ETS2
Official Gene Full Name V-ets erythroblastosis virus E26 oncogene homolog 2 (avian)
Alias Symbols ETS2IT1
NCBI Gene Id 2114
Protein Name Protein C-ets-2
Description of Target ETS2 contains an ETS DNA-binding domain and belongs to the ETS family. ETS2 is a target of protein kinase C and upregulates GM-CSF. Ets2 and its targets play essential roles in endothelial cell function. Coexpression of Ets-2 and SRC-1 significantly associated with the rate of recurrence and HER expression in breast cancer. Overexpression of ETS2 is associated with human esophageal squamous cell carcinoma. ETS transcriptions factors, such as ETS2, regulate numerous genes and are involved in stem cell development, cell senescence and death, and tumorigenesis. The conserved ETS domain within these proteins is a winged helix-turn-helix DNA-binding domain that recognizes the core consensus DNA sequence GGAA/T of target genes (Dwyer et al., 2007 [PubMed 17986575]).[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Swissprot Id P15036
Protein Accession # NP_005230
Nucleotide Accession # NM_005239
Protein Size (# AA) 469
Molecular Weight 53kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express ETS2.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express ETS2.
Protein Interactions UBC; RFWD2; TWIST1; POU5F1; TWIST2; ZFYVE9; SRA1; XPO1; TP53; SUMO2; EP300; CREBBP; NCOR1; NCOA3; SRC; ZMYND11; TDP2; STAT5B; CDK10; SMARCA4; JUN; ERG; ETS2; ETS1; NR3C1; GATA3; FOS; SPI1; BRCA1;
  1. What is the species homology for "ETS2 Antibody - C-terminal region : Biotin (P100751_P050-Biotin)"?

    The tested species reactivity for this item is "". This antibody is predicted to have homology to "Cow, Dog, Human, Mouse, Rat, Sheep".

  2. How long will it take to receive "ETS2 Antibody - C-terminal region : Biotin (P100751_P050-Biotin)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "ETS2 Antibody - C-terminal region : Biotin (P100751_P050-Biotin)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "ETS2 Antibody - C-terminal region : Biotin (P100751_P050-Biotin)"?

    This target may also be called "ETS2IT1" in publications.

  5. What is the shipping cost for "ETS2 Antibody - C-terminal region : Biotin (P100751_P050-Biotin)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "ETS2 Antibody - C-terminal region : Biotin (P100751_P050-Biotin)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "ETS2 Antibody - C-terminal region : Biotin (P100751_P050-Biotin)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "53kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "ETS2 Antibody - C-terminal region : Biotin (P100751_P050-Biotin)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "ETS2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "ETS2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "ETS2"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "ETS2"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "ETS2"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "ETS2"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:ETS2 Antibody - C-terminal region : Biotin (P100751_P050-Biotin)
Your Rating
We found other products you might like!