ETFA Antibody - middle region (ARP54290_P050)

Catalog No: ARP54290_P050

WB Suggested Anti-ETFA Antibody Titration: 0.2-1 ug/ml
Positive Control: Human heart

Rabbit Anti-ETFA antibody
Catalog Number: ARP54290
Formalin Fixed Paraffin Embedded Tissue: Human Colon
Primary antibody Concentration: 1:66.7
Secondary Antibody: Donkey anti-Rabbit-Cy3
Secondary Antibody Concentration: 1:200
Magnification: 20x
Exposure Time: 0.5-2.0sec

Rabbit Anti-ETFA antibody
Catalog Number: ARP54290
Formalin Fixed Paraffin Embedded Tissue: Human Liver
Primary antibody Concentration: 1:66.7
Secondary Antibody: Donkey anti-Rabbit-Cy3
Secondary Antibody Concentration: 1:200
Magnification: 20x
Exposure Time: 0.5-2.0sec

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit, Yeast, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ETFA
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Goat: 86%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 92%; Zebrafish: 93%
• Peptide Sequence: Synthetic peptide located within the following region: VVSGGRGLKSGENFKLLYDLADQLHAAVGASRAAVDAGFVPNDMQVGQTG
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-ETFA (ARP54290_P050) antibody is Catalog # AAP54290 (Previous Catalog # AAPP31039)
• Subunit: alpha, mitochondrial
• Reference: Chiong,M.A., Mol. Genet. Metab. 92 (1-2), 109-114 (2007)

Target Info

• Gene Symbol: ETFA
• Gene Full Name: Electron-transfer-flavoprotein, alpha polypeptide
• Alias Symbols: EMA, GA2, MADD
• NCBI Gene Id: 2108
• Protein Name: Electron transfer flavoprotein subunit alpha, mitochondrial
• Description of Target: ETFA participates in catalyzing the initial step of the mitochondrial fatty acid beta-oxidation. It shuttles electrons between primary flavoprotein dehydrogenases and the membrane-bound electron transfer flavoprotein ubiquinone oxidoreductase. Defects in electron-transfer-flavoprotein have been implicated in type II glutaricaciduria in which multiple acyl-CoA dehydrogenase deficiencies result in large excretion of glutaric, lactic, ethylmalonic, butyric, isobutyric, 2-methyl-butyric, and isovaleric acids.ETFA participates in catalyzing the initial step of the mitochondrial fatty acid beta-oxidation. It shuttles electrons between primary flavoprotein dehydrogenases and the membrane-bound electron transfer flavoprotein ubiquinone oxidoreductase. Defects in electron-transfer-flavoprotein have been implicated in type II glutaricaciduria in which multiple acyl-CoA dehydrogenase deficiencies result in large excretion of glutaric, lactic, ethylmalonic, butyric, isobutyric, 2-methyl-butyric, and isovaleric acids. Two transcript variants encoding different isoforms have been found for this gene.
• Uniprot ID: P13804
• Protein Accession #: NP_000117
• Nucleotide Accession #: NM_000126
• Protein Size (# AA): 333
• Molecular Weight: 35kDa
• Protein Interactions: SUMO2; MDM2; PSEN1; PPP6R3; BAG3; TPM1; UBC; SORD; HADHA; ETFB; CDC42; HDAC5; MYC; ICT1; UBA5; DDA1; ATG101;