Size:100 ul
$249.00
In Stock
SKU
ARP31655_T100
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP31655_T100-FITC Conjugated

ARP31655_T100-HRP Conjugated

ARP31655_T100-Biotin Conjugated

More Information
Tested Species Reactivity Human, Mouse
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application IHC, WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-133561 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human ESRRG
Purification Protein A purified
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Complete computational species homology data Anti-ESRRG (ARP31655_T100)
Peptide Sequence Synthetic peptide located within the following region: RIDAENSPYLNPQLVQPAKKPYNKIVSHLLVAEPEKIYAMPDPTVPDSDI
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-ESRRG (ARP31655_T100) antibody is Catalog # AAP31655 (Previous Catalog # AAPP02442)
Datasheets/Manuals Printable datasheet for anti-ESRRG (ARP31655_T100) antibody
Target Reference Hentschke,M., et al., (2003) Biochem. Biophys. Res. Commun. 312 (4), 975-982
Publications

Song, G. & Wang, L. A conserved gene structure and expression regulation of miR-433 and miR-127 in mammals. PLoS One 4, e7829 (2009). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish 19946636

Song, G. & Wang, L. Transcriptional mechanism for the paired miR-433 and miR-127 genes by nuclear receptors SHP and ERRgamma. Nucleic Acids Res. 36, 5727-35 (2008). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish 18776219

Gene Symbol ESRRG
Official Gene Full Name Estrogen-related receptor gamma
Alias Symbols ERR3, NR3B3, ERRgamma
NCBI Gene Id 2104
Protein Name Estrogen-related receptor gamma
Description of Target ERRs, which are coexpressed with ERs in prostatic cells, could regulate cell growth and modulate ER-mediated pathways via interference on ERalpha transcription in prostatic cells. Not only PNRC2 but also the corepressor TLE1 functioned as ERRgamma coactivator in a reporter gene analysis. Transcriptional activation by ERR3 can be ligand-independent.
Swissprot Id P62508
Protein Accession # NP_996318
Nucleotide Accession # NM_206595
Protein Size (# AA) 458
Molecular Weight 51kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express ESRRG.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express ESRRG.
Protein Interactions MEOX2; KIFC3; ESRRG; NR0B1; SUMO1P1; CCDC67; KIAA1598; NUP160; SRPK1; SRA1; PPARGC1A; APP; PNRC2; NR0B2; TLE1; ESRRA; EIF3I; NRIP1; SRC; PROX1; DUT; ARHGEF15; PNRC1; EBP; UBC; PARK2; DPF2; SP1; PPARGC1B; DAXX; NCOA1; CALM1; HGS;
  1. What is the species homology for "ESRRG Antibody - middle region (ARP31655_T100)"?

    The tested species reactivity for this item is "Human, Mouse". This antibody is predicted to have homology to "Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish".

  2. How long will it take to receive "ESRRG Antibody - middle region (ARP31655_T100)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "ESRRG Antibody - middle region (ARP31655_T100)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "ESRRG Antibody - middle region (ARP31655_T100)"?

    This target may also be called "ERR3, NR3B3, ERRgamma" in publications.

  5. What is the shipping cost for "ESRRG Antibody - middle region (ARP31655_T100)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "ESRRG Antibody - middle region (ARP31655_T100)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "ESRRG Antibody - middle region (ARP31655_T100)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "51kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "ESRRG Antibody - middle region (ARP31655_T100)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "ESRRG"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "ESRRG"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "ESRRG"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "ESRRG"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "ESRRG"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "ESRRG"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:ESRRG Antibody - middle region (ARP31655_T100)
Your Rating
We found other products you might like!