Search Antibody, Protein, and ELISA Kit Solutions

ESRRG antibody - middle region (ARP31655_T100)

100 ul
$249.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP31655_T100-FITC Conjugated

ARP31655_T100-HRP Conjugated

ARP31655_T100-Biotin Conjugated

Gene Symbol:
ESRRG
NCBI Gene Id:
2104
Official Gene Full Name:
Estrogen-related receptor gamma
Protein Name:
Estrogen-related receptor gamma
Swissprot Id:
P62508
Protein Accession #:
NP_996318
Nucleotide Accession #:
NM_206595
Alias Symbols:
ERR3, NR3B3, ERRgamma
Replacement Item:
This antibody may replace item sc-133561 from Santa Cruz Biotechnology.
Description of Target:
ERRs, which are coexpressed with ERs in prostatic cells, could regulate cell growth and modulate ER-mediated pathways via interference on ERalpha transcription in prostatic cells. Not only PNRC2 but also the corepressor TLE1 functioned as ERRgamma coactivator in a reporter gene analysis. Transcriptional activation by ERR3 can be ligand-independent.
Protein Size (# AA):
458
Molecular Weight:
51kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Protein A purified
Application:
IHC, WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express ESRRG.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express ESRRG.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human ESRRG
Tested Species Reactivity:
Human, Mouse
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Complete computational species homology data:
Anti-ESRRG (ARP31655_T100)
Peptide Sequence:
Synthetic peptide located within the following region: RIDAENSPYLNPQLVQPAKKPYNKIVSHLLVAEPEKIYAMPDPTVPDSDI
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
MEOX2; KIFC3; ESRRG; NR0B1; SUMO1P1; CCDC67; KIAA1598; NUP160; SRPK1; SRA1; PPARGC1A; APP; PNRC2; NR0B2; TLE1; ESRRA; EIF3I; NRIP1; SRC; PROX1; DUT; ARHGEF15; PNRC1; EBP; UBC; PARK2; DPF2; SP1; PPARGC1B; DAXX; NCOA1; CALM1; HGS;
Blocking Peptide:
For anti-ESRRG (ARP31655_T100) antibody is Catalog # AAP31655 (Previous Catalog # AAPP02442)
Datasheets/Manuals:
Printable datasheet for anti-ESRRG (ARP31655_T100) antibody
Target Reference:
Hentschke,M., et al., (2003) Biochem. Biophys. Res. Commun. 312 (4), 975-982
Publications:

Song, G. & Wang, L. Transcriptional mechanism for the paired miR-433 and miR-127 genes by nuclear receptors SHP and ERRgamma. Nucleic Acids Res. 36, 5727-35 (2008). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish 18776219

Song, G. & Wang, L. A conserved gene structure and expression regulation of miR-433 and miR-127 in mammals. PLoS One 4, e7829 (2009). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish 19946636

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...