Search Antibody, Protein, and ELISA Kit Solutions

ESRRG Antibody - middle region (ARP31655_T100)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP31655_T100-FITC Conjugated

ARP31655_T100-HRP Conjugated

ARP31655_T100-Biotin Conjugated

Tested Species Reactivity:
Human, Mouse
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item:
This antibody may replace item sc-133561 from Santa Cruz Biotechnology.
The immunogen is a synthetic peptide directed towards the middle region of human ESRRG
Protein A purified
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Complete computational species homology data:
Anti-ESRRG (ARP31655_T100)
Peptide Sequence:
Synthetic peptide located within the following region: RIDAENSPYLNPQLVQPAKKPYNKIVSHLLVAEPEKIYAMPDPTVPDSDI
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-ESRRG (ARP31655_T100) antibody is Catalog # AAP31655 (Previous Catalog # AAPP02442)
Printable datasheet for anti-ESRRG (ARP31655_T100) antibody
Target Reference:
Hentschke,M., et al., (2003) Biochem. Biophys. Res. Commun. 312 (4), 975-982

Song, G. & Wang, L. A conserved gene structure and expression regulation of miR-433 and miR-127 in mammals. PLoS One 4, e7829 (2009). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish 19946636

Song, G. & Wang, L. Transcriptional mechanism for the paired miR-433 and miR-127 genes by nuclear receptors SHP and ERRgamma. Nucleic Acids Res. 36, 5727-35 (2008). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish 18776219

Gene Symbol:
Official Gene Full Name:
Estrogen-related receptor gamma
Alias Symbols:
ERR3, NR3B3, ERRgamma
NCBI Gene Id:
Protein Name:
Estrogen-related receptor gamma
Description of Target:
ERRs, which are coexpressed with ERs in prostatic cells, could regulate cell growth and modulate ER-mediated pathways via interference on ERalpha transcription in prostatic cells. Not only PNRC2 but also the corepressor TLE1 functioned as ERRgamma coactivator in a reporter gene analysis. Transcriptional activation by ERR3 can be ligand-independent.
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Protein Size (# AA):
Molecular Weight:
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express ESRRG.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express ESRRG.
Protein Interactions:

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...