Size:100 ul
$249.00
In stock
SKU
ARP31655_T100
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP31655_T100-FITC Conjugated

ARP31655_T100-HRP Conjugated

ARP31655_T100-Biotin Conjugated

More Information
Tested Species Reactivity Human, Mouse
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application IHC, WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-133561 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human ESRRG
Purification Protein A purified
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Complete computational species homology data Anti-ESRRG (ARP31655_T100)
Peptide Sequence Synthetic peptide located within the following region: RIDAENSPYLNPQLVQPAKKPYNKIVSHLLVAEPEKIYAMPDPTVPDSDI
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-ESRRG (ARP31655_T100) antibody is Catalog # AAP31655 (Previous Catalog # AAPP02442)
Datasheets/Manuals Printable datasheet for anti-ESRRG (ARP31655_T100) antibody
Target Reference Hentschke,M., et al., (2003) Biochem. Biophys. Res. Commun. 312 (4), 975-982
Publications

Song, G. & Wang, L. A conserved gene structure and expression regulation of miR-433 and miR-127 in mammals. PLoS One 4, e7829 (2009). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish 19946636

Song, G. & Wang, L. Transcriptional mechanism for the paired miR-433 and miR-127 genes by nuclear receptors SHP and ERRgamma. Nucleic Acids Res. 36, 5727-35 (2008). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish 18776219

Gene Symbol ESRRG
Official Gene Full Name Estrogen-related receptor gamma
Alias Symbols ERR3, NR3B3, ERRgamma
NCBI Gene Id 2104
Protein Name Estrogen-related receptor gamma
Description of Target ERRs, which are coexpressed with ERs in prostatic cells, could regulate cell growth and modulate ER-mediated pathways via interference on ERalpha transcription in prostatic cells. Not only PNRC2 but also the corepressor TLE1 functioned as ERRgamma coactivator in a reporter gene analysis. Transcriptional activation by ERR3 can be ligand-independent.
Swissprot Id P62508
Protein Accession # NP_996318
Nucleotide Accession # NM_206595
Protein Size (# AA) 458
Molecular Weight 51kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express ESRRG.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express ESRRG.
Protein Interactions MEOX2; KIFC3; ESRRG; NR0B1; SUMO1P1; CCDC67; KIAA1598; NUP160; SRPK1; SRA1; PPARGC1A; APP; PNRC2; NR0B2; TLE1; ESRRA; EIF3I; NRIP1; SRC; PROX1; DUT; ARHGEF15; PNRC1; EBP; UBC; PARK2; DPF2; SP1; PPARGC1B; DAXX; NCOA1; CALM1; HGS;
Write Your Own Review
You're reviewing:ESRRG Antibody - middle region (ARP31655_T100)
Your Rating