Search Antibody, Protein, and ELISA Kit Solutions

ESRRB Antibody - middle region (ARP89587_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Tested Species Reactivity:
Mouse
Predicted Species Reactivity:
Mouse
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality:
Polyclonal
Host:
Rabbit
Application:
WB
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
ESRRB
Official Gene Full Name:
estrogen related receptor, beta
NCBI Gene Id:
26380
Protein Name:
steroid hormone receptor ERR2
Swissprot Id:
Q61539
Protein Accession #:
NP_001152972.1
Nucleotide Accession #:
NM_001159500.1
Alias Symbols:
Err2, Errb, Nr3b2, Estrrb
Description of Target:
Transcription factor that binds a canonical ESRRB recognition (ERRE) sequence 5'TCAAGGTCA-3' localized on promoter and enhancer of targets genes regulating their expression or their transcriptional activity. Plays a role, in a LIF-independent manner, in maintainance of self-renewal and pluripotency of embryonic and trophoblast stem cells through different signaling pathways including FGF signaling pathway and Wnt signaling pathways. Upon FGF signaling pathway activation, interacts with KDM1A by directly binding to enhancer site of ELF5 and EOMES and activating their transcription leading to self-renewal of trophoblast stem cells. Also regulates expression of multiple rod-specific genes and is required for survival of this cell type. Plays a role as transcription factor activator of GATA6, NR0B1, POU5F1 and PERM1. Plays a role as transcription factor repressor of NFE2L2 transcriptional activity and ESR1 transcriptional activity (By similarity). During mitosis remains bound to a subset of interphase target genes, including pluripotency regulators, through the canonical ESRRB recognition (ERRE) sequence, leading to their transcriptional activation in early G1 phase. Can coassemble on structured DNA elements with other transcription factors like SOX2, POU5F1, KDM1A and NCOA3 to trigger ESRRB-dependent gene activation. This mechanism, in the case of SOX2 corecruitment prevents the embryonic stem cells (ESCs) to epiblast stem cells (EpiSC) transition through positive regulation of NR0B1 that inhibits the EpiSC transcriptional program (PubMed:23169531). Also plays a role inner ear development by controlling expression of ion channels and transporters and in early placentation.
Protein Size (# AA):
433
Molecular Weight:
47 kDa
Purification:
Affinity purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express ESRRB.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express ESRRB.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of mouse ESRRB
Peptide Sequence:
Synthetic peptide located within the following region: DRVRGGRQKYKRRLDSENSPYLNLPISPPAKKPLTKIVSNLLGVEQDKLY
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-ESRRB (ARP89587_P050) antibody is Catalog # AAP89587
Datasheets/Manuals:
Printable datasheet for anti-ESRRB (ARP89587_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...