Size:100 ul
Special Price $229.00 Regular Price $289.00
In Stock
SKU
ARP89587_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

ESRRB Antibody - middle region (ARP89587_P050)

Catalog#: ARP89587_P050
Domestic: within 24 hours delivery | International: 3-5 business days
More Information
Tested Species ReactivityMouse
Predicted Species ReactivityMouse
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of mouse ESRRB
PurificationAffinity purified
Peptide SequenceSynthetic peptide located within the following region: DRVRGGRQKYKRRLDSENSPYLNLPISPPAKKPLTKIVSNLLGVEQDKLY
ConcentrationBatch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking PeptideFor anti-ESRRB (ARP89587_P050) antibody is Catalog # AAP89587
Datasheets/ManualsPrintable datasheet for anti-ESRRB (ARP89587_P050) antibody
Gene SymbolESRRB
Official Gene Full Nameestrogen related receptor, beta
Alias SymbolsErr2, Errb, Nr3b2, Estrrb
NCBI Gene Id26380
Protein Namesteroid hormone receptor ERR2
Description of TargetTranscription factor that binds a canonical ESRRB recognition (ERRE) sequence 5'TCAAGGTCA-3' localized on promoter and enhancer of targets genes regulating their expression or their transcriptional activity. Plays a role, in a LIF-independent manner, in maintainance of self-renewal and pluripotency of embryonic and trophoblast stem cells through different signaling pathways including FGF signaling pathway and Wnt signaling pathways. Upon FGF signaling pathway activation, interacts with KDM1A by directly binding to enhancer site of ELF5 and EOMES and activating their transcription leading to self-renewal of trophoblast stem cells. Also regulates expression of multiple rod-specific genes and is required for survival of this cell type. Plays a role as transcription factor activator of GATA6, NR0B1, POU5F1 and PERM1. Plays a role as transcription factor repressor of NFE2L2 transcriptional activity and ESR1 transcriptional activity (By similarity). During mitosis remains bound to a subset of interphase target genes, including pluripotency regulators, through the canonical ESRRB recognition (ERRE) sequence, leading to their transcriptional activation in early G1 phase. Can coassemble on structured DNA elements with other transcription factors like SOX2, POU5F1, KDM1A and NCOA3 to trigger ESRRB-dependent gene activation. This mechanism, in the case of SOX2 corecruitment prevents the embryonic stem cells (ESCs) to epiblast stem cells (EpiSC) transition through positive regulation of NR0B1 that inhibits the EpiSC transcriptional program (PubMed:23169531). Also plays a role inner ear development by controlling expression of ion channels and transporters and in early placentation.
Swissprot IdQ61539
Protein Accession #NP_001152972.1
Nucleotide Accession #NM_001159500.1
Protein Size (# AA)433
Molecular Weight47 kDa
Tissue ToolFind tissues and cell lines supported by DNA array analysis to express ESRRB.
RNA SeqFind tissues and cell lines supported by RNA-seq analysis to express ESRRB.
Write Your Own Review
You're reviewing:ESRRB Antibody - middle region (ARP89587_P050)
Your Rating
Aviva Tissue Tool
Aviva ChIP Antibodies
Aviva Travel Grant
Assay Development