Esr2 Antibody - N-terminal region : Biotin (ARP37039_P050-Biotin)

Catalog No: ARP37039_P050-Biotin

Size:100ul

Product Info

• Predicted Species Reactivity: Mouse, Rat
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
• Clonality: Polyclonal
• Host: Rabbit
• Conjugation: Biotin
• Application: WB
• Reconstitution and Storage: All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
• Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Mouse: 100%; Rat: 83%
• Peptide Sequence: Synthetic peptide located within the following region: IPSSYVESRHEYSAMTFYSPAVMNYSVPSSTGNLEGGPVRQTASPNVLWP
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-Esr2 (ARP37039_P050-Biotin) antibody is Catalog # AAP37039 (Previous Catalog # AAPP09237)

Target Info

• Gene Symbol: Esr2
• Gene Full Name: Estrogen receptor 2 (beta)
• Alias Symbols: Est, ERbe, ER[b], Estrb, ERbeta
• NCBI Gene Id: 13983
• Protein Name: Estrogen receptor beta
• Description of Target: The function of this protein remains unknown.
• Uniprot ID: Q8BG65
• Protein Accession #: NP_997590
• Nucleotide Accession #: NM_207707
• Protein Size (# AA): 567
• Molecular Weight: 63kDa
• Protein Interactions: Apc; Rbm39;