ERVWE1 Antibody - N-terminal region (ARP47043_P050)

Catalog No: ARP47043_P050

Click here to learn more about Aviva's By-Request Conjugation Service.

WB Suggested Anti-ERVWE1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: MCF7 cell lysate

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ERVWE1
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Human: 100%; Rabbit: 91%
• Peptide Sequence: Synthetic peptide located within the following region: TQTGMSDGGGVQDQAREKHVKEVISQLTRVHGTSSPYKGLDLSKLHETLR
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-ERVW-1 (ARP47043_P050) antibody is Catalog # AAP47043 (Previous Catalog # AAPP27841)
• Reference: Mangeney,M., (2007) Proc. Natl. Acad. Sci. U.S.A. 104 (51), 20534-20539

Target Info

• Gene Symbol: ERVW-1
• Gene Full Name: Endogenous retrovirus group W, member 1
• Alias Symbols: ENV, ENVW, HERVW, ERVWE1, HERV7Q, HERV-7q, HERVWENV, HERV-W-ENV
• NCBI Gene Id: 30816
• Protein Name: HERV-W_7q21.2 provirus ancestral Env polyprotein
• Description of Target: ERVWE1 or syncytin, is expressed in the placental syncytiotrophoblast and is involved in fusion of the cytotrophoblast cells to form the syncytial layer of the placenta. The protein has the characteristics of a typical retroviral envelope protein, including a furin cleavage site that separates the surface (SU) and transmembrane (TM) proteins which form a heterodimer. Alternatively spliced transcript variants encoding the same protein have been found for this gene.Many different human endogenous retrovirus (HERV) families are expressed in normal placental tissue at high levels, suggesting that HERVs are functionally important in reproduction. This gene is part of an HERV provirus on chromosome 7 that has inactivating mutations in the gag and pol genes. This gene is the envelope glycoprotein gene which appears to have been selectively preserved. The product of this gene, syncytin, is expressed in the placental syncytiotrophoblast and is involved in fusion of the cytotrophoblast cells to form the syncytial layer of the placenta. The protein has the characteristics of a typical retroviral envelope protein, including a furin cleavage site that separates the surface (SU) and transmembrane (TM) proteins which form a heterodimer. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
• Uniprot ID: Q9UQF0
• Protein Accession #: NP_055405
• Nucleotide Accession #: NM_014590
• Protein Size (# AA): 538
• Molecular Weight: 24kDa
• Protein Interactions: SLC1A4; SLC1A5;