Size:100 ul
Special Price $229.00 Regular Price $289.00
In Stock
SKU
ARP58461_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP58461_P050-FITC Conjugated

ARP58461_P050-HRP Conjugated

ARP58461_P050-Biotin Conjugated

ERLIN2 Antibody - middle region (ARP58461_P050)

Catalog#: ARP58461_P050
Domestic: within 1-2 days delivery | International: 1-2 days
Click here to learn more about Aviva's By-Request Conjugation Service.
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Human, Mouse, Pig, Rabbit, Rat
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human ERLIN2
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Human: 100%; Mouse: 86%; Pig: 79%; Rabbit: 100%; Rat: 93%
Complete computational species homology data Anti-ERLIN2 (ARP58461_P050)
Peptide Sequence Synthetic peptide located within the following region: ASNSKIYFGKDIPNMFMDSAGSVSKQFEGLADKLSFGLEDEPLETATKEN
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-ERLIN2 (ARP58461_P050) antibody is Catalog # AAP58461 (Previous Catalog # AAPP34734)
Datasheets/Manuals Printable datasheet for anti-ERLIN2 (ARP58461_P050) antibody
Sample Type Confirmation

ERLIN2 is strongly supported by BioGPS gene expression data to be expressed in 721_B, HEK293T

Target Reference Pearce,M.M., (2007) J. Biol. Chem. 282 (28), 20104-20115
Publications

Zhang, Y. et al. Effects of 1.8 GHz radiofrequency radiation on protein expression in human lens epithelial cells. Hum. Exp. Toxicol. 32, 797-806 (2013). WB, Human, Mouse, Pig, Rabbit, Rat 23338683

Gene Symbol ERLIN2
Official Gene Full Name ER lipid raft associated 2
Alias Symbols C8orf2, Erlin-2, MGC87072, SPFH2, NET32, SPG18
NCBI Gene Id 11160
Protein Name Erlin-2
Description of Target ERLIN2 plays an important role in the early steps of the endoplasmic reticulum-associated degradation (ERAD) pathway. It is involved in ITPR1 degradation by the ERAD pathway.
Swissprot Id O94905
Protein Accession # NP_009106
Nucleotide Accession # NM_007175
Protein Size (# AA) 339
Molecular Weight 38kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express ERLIN2.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express ERLIN2.
Protein Interactions TIMM50; TMUB1; SRPRB; CCDC47; RHOT1; SEC61B; ERLIN1; HAX1; TRIM28; UBC; HSP90B1; TCP1; HSPA5; HSPA4; CSE1L; CASP8; CANX; ATP2A2; PSENEN; APH1A; NCSTN; SCAP; SREBF2; SREBF1; PSEN1; INSIG1; AMFR; PPP6R3; STK3; ADRA1D; ADRB2; HDAC11; CLN3; MMS19; UBL4A; FN1;
  1. What is the species homology for "ERLIN2 Antibody - middle region (ARP58461_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Pig, Rabbit, Rat".

  2. How long will it take to receive "ERLIN2 Antibody - middle region (ARP58461_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "ERLIN2 Antibody - middle region (ARP58461_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "ERLIN2 Antibody - middle region (ARP58461_P050)"?

    This target may also be called "C8orf2, Erlin-2, MGC87072, SPFH2, NET32, SPG18" in publications.

  5. What is the shipping cost for "ERLIN2 Antibody - middle region (ARP58461_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "ERLIN2 Antibody - middle region (ARP58461_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "ERLIN2 Antibody - middle region (ARP58461_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "38kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "ERLIN2 Antibody - middle region (ARP58461_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "ERLIN2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "ERLIN2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "ERLIN2"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "ERLIN2"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "ERLIN2"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "ERLIN2"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:ERLIN2 Antibody - middle region (ARP58461_P050)
Your Rating
We found other products you might like!