Search Antibody, Protein, and ELISA Kit Solutions

ERLIN2 Antibody - middle region (ARP58461_P050)

Click here to learn more about Aviva's By-Request Conjugation Service.
100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP58461_P050-FITC Conjugated

ARP58461_P050-HRP Conjugated

ARP58461_P050-Biotin Conjugated

Click here to learn more about Aviva's By-Request Conjugation Service.
Gene Symbol:
ERLIN2
Official Gene Full Name:
ER lipid raft associated 2
NCBI Gene Id:
11160
Protein Name:
Erlin-2
Swissprot Id:
O94905
Protein Accession #:
NP_009106
Nucleotide Accession #:
NM_007175
Alias Symbols:
C8orf2, Erlin-2, MGC87072, SPFH2, NET32, SPG18
Description of Target:
ERLIN2 plays an important role in the early steps of the endoplasmic reticulum-associated degradation (ERAD) pathway. It is involved in ITPR1 degradation by the ERAD pathway.
Protein Size (# AA):
339
Molecular Weight:
38kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express ERLIN2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express ERLIN2.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human ERLIN2
Predicted Species Reactivity:
Human, Mouse, Pig, Rabbit, Rat
Tested Species Reactivity:
Human
Predicted Homology Based on Immunogen Sequence:
Human: 100%; Mouse: 86%; Pig: 79%; Rabbit: 100%; Rat: 93%
Complete computational species homology data:
Anti-ERLIN2 (ARP58461_P050)
Peptide Sequence:
Synthetic peptide located within the following region: ASNSKIYFGKDIPNMFMDSAGSVSKQFEGLADKLSFGLEDEPLETATKEN
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
TIMM50; TMUB1; SRPRB; CCDC47; RHOT1; SEC61B; ERLIN1; HAX1; TRIM28; UBC; HSP90B1; TCP1; HSPA5; HSPA4; CSE1L; CASP8; CANX; ATP2A2; PSENEN; APH1A; NCSTN; SCAP; SREBF2; SREBF1; PSEN1; INSIG1; AMFR; PPP6R3; STK3; ADRA1D; ADRB2; HDAC11; CLN3; MMS19; UBL4A; FN1;
Blocking Peptide:
For anti-ERLIN2 (ARP58461_P050) antibody is Catalog # AAP58461 (Previous Catalog # AAPP34734)
Datasheets/Manuals:
Printable datasheet for anti-ERLIN2 (ARP58461_P050) antibody
Sample Type Confirmation:

ERLIN2 is strongly supported by BioGPS gene expression data to be expressed in 721_B, HEK293T

Target Reference:
Pearce,M.M., (2007) J. Biol. Chem. 282 (28), 20104-20115
Publications:

Zhang, Y. et al. Effects of 1.8 GHz radiofrequency radiation on protein expression in human lens epithelial cells. Hum. Exp. Toxicol. 32, 797-806 (2013). WB, Human, Mouse, Pig, Rabbit, Rat 23338683

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...