Size:100 ul
Special Price $229.00 Regular Price $289.00
In stock
SKU
ARP58461_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP58461_P050-FITC Conjugated

ARP58461_P050-HRP Conjugated

ARP58461_P050-Biotin Conjugated

ERLIN2 Antibody - middle region (ARP58461_P050)

Catalog#: ARP58461_P050
Domestic: within 1-2 days delivery International: 1-2 days
Click here to learn more about Aviva's By-Request Conjugation Service.
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Human, Mouse, Pig, Rabbit, Rat
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human ERLIN2
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Human: 100%; Mouse: 86%; Pig: 79%; Rabbit: 100%; Rat: 93%
Complete computational species homology data Anti-ERLIN2 (ARP58461_P050)
Peptide Sequence Synthetic peptide located within the following region: ASNSKIYFGKDIPNMFMDSAGSVSKQFEGLADKLSFGLEDEPLETATKEN
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-ERLIN2 (ARP58461_P050) antibody is Catalog # AAP58461 (Previous Catalog # AAPP34734)
Datasheets/Manuals Printable datasheet for anti-ERLIN2 (ARP58461_P050) antibody
Sample Type Confirmation

ERLIN2 is strongly supported by BioGPS gene expression data to be expressed in 721_B, HEK293T

Target Reference Pearce,M.M., (2007) J. Biol. Chem. 282 (28), 20104-20115
Publications

Zhang, Y. et al. Effects of 1.8 GHz radiofrequency radiation on protein expression in human lens epithelial cells. Hum. Exp. Toxicol. 32, 797-806 (2013). WB, Human, Mouse, Pig, Rabbit, Rat 23338683

Gene Symbol ERLIN2
Official Gene Full Name ER lipid raft associated 2
Alias Symbols C8orf2, Erlin-2, MGC87072, SPFH2, NET32, SPG18
NCBI Gene Id 11160
Protein Name Erlin-2
Description of Target ERLIN2 plays an important role in the early steps of the endoplasmic reticulum-associated degradation (ERAD) pathway. It is involved in ITPR1 degradation by the ERAD pathway.
Swissprot Id O94905
Protein Accession # NP_009106
Nucleotide Accession # NM_007175
Protein Size (# AA) 339
Molecular Weight 38kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express ERLIN2.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express ERLIN2.
Protein Interactions TIMM50; TMUB1; SRPRB; CCDC47; RHOT1; SEC61B; ERLIN1; HAX1; TRIM28; UBC; HSP90B1; TCP1; HSPA5; HSPA4; CSE1L; CASP8; CANX; ATP2A2; PSENEN; APH1A; NCSTN; SCAP; SREBF2; SREBF1; PSEN1; INSIG1; AMFR; PPP6R3; STK3; ADRA1D; ADRB2; HDAC11; CLN3; MMS19; UBL4A; FN1;
Write Your Own Review
You're reviewing:ERLIN2 Antibody - middle region (ARP58461_P050)
Your Rating