Size:100 ul
Special Price $229.00 Regular Price $289.00
In Stock
SKU
ARP34556_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP34556_P050-FITC Conjugated

ARP34556_P050-HRP Conjugated

ARP34556_P050-Biotin Conjugated

ERGIC2 Antibody - middle region (ARP34556_P050)

Catalog#: ARP34556_P050
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species ReactivityHuman
Predicted Species ReactivityCow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement ItemThis antibody may replace item sc-109266 from Santa Cruz Biotechnology.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human ERGIC2
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 93%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 79%
Complete computational species homology dataAnti-ERGIC2 (ARP34556_P050)
Peptide SequenceSynthetic peptide located within the following region: TVVPTKLHTYKISADTHQFSVTERERIINHAAGSHGVSGIFMKYDLSSLM
ConcentrationBatch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking PeptideFor anti-ERGIC2 (ARP34556_P050) antibody is Catalog # AAP34556 (Previous Catalog # AAPP05738)
Datasheets/ManualsPrintable datasheet for anti-ERGIC2 (ARP34556_P050) antibody
Target ReferenceYang,Y.F., (2008) Biochim. Biophys. Acta 1784 (2), 312-318
Publications

Nelson, T. J. & Alkon, D. L. Protection against beta-amyloid-induced apoptosis by peptides interacting with beta-amyloid. J. Biol. Chem. 282, 31238-49 (2007). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish 17761669

Gene SymbolERGIC2
Official Gene Full NameERGIC and golgi 2
Alias SymbolsCDA14, Erv41, MGC111152, PTX1, cd002
NCBI Gene Id51290
Protein NameEndoplasmic reticulum-Golgi intermediate compartment protein 2
Description of TargetERGIC2 belongs to the ERGIC family.It possible play role in transport between endoplasmic reticulum and Golgi.
Swissprot IdQ96RQ1
Protein Accession #NP_057654
Nucleotide Accession #NM_016570
Protein Size (# AA)377
Molecular Weight42kDa
Tissue ToolFind tissues and cell lines supported by DNA array analysis to express ERGIC2.
RNA SeqFind tissues and cell lines supported by RNA-seq analysis to express ERGIC2.
Protein Interactionsenv; UBC; Copa;
Write Your Own Review
You're reviewing:ERGIC2 Antibody - middle region (ARP34556_P050)
Your Rating
Free Microscope
Aviva Validation Data
Aviva Blast Tool
Aviva Travel Grant