Search Antibody, Protein, and ELISA Kit Solutions

ERGIC2 Antibody - middle region (ARP34556_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP34556_P050-FITC Conjugated

ARP34556_P050-HRP Conjugated

ARP34556_P050-Biotin Conjugated

Tested Species Reactivity:
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
Official Gene Full Name:
ERGIC and golgi 2
NCBI Gene Id:
Protein Name:
Endoplasmic reticulum-Golgi intermediate compartment protein 2
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
CDA14, Erv41, MGC111152, PTX1, cd002
Replacement Item:
This antibody may replace item sc-109266 from Santa Cruz Biotechnology.
Description of Target:
ERGIC2 belongs to the ERGIC family.It possible play role in transport between endoplasmic reticulum and Golgi.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express ERGIC2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express ERGIC2.
The immunogen is a synthetic peptide directed towards the middle region of human ERGIC2
Predicted Homology Based on Immunogen Sequence:
Cow: 93%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 79%
Complete computational species homology data:
Anti-ERGIC2 (ARP34556_P050)
Peptide Sequence:
Synthetic peptide located within the following region: TVVPTKLHTYKISADTHQFSVTERERIINHAAGSHGVSGIFMKYDLSSLM
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
env; UBC; Copa;
Blocking Peptide:
For anti-ERGIC2 (ARP34556_P050) antibody is Catalog # AAP34556 (Previous Catalog # AAPP05738)
Printable datasheet for anti-ERGIC2 (ARP34556_P050) antibody
Target Reference:
Yang,Y.F., (2008) Biochim. Biophys. Acta 1784 (2), 312-318

Nelson, T. J. & Alkon, D. L. Protection against beta-amyloid-induced apoptosis by peptides interacting with beta-amyloid. J. Biol. Chem. 282, 31238-49 (2007). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish 17761669

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...