Search Antibody, Protein, and ELISA Kit Solutions

ERF Antibody - C-terminal region : FITC (ARP76132_P050-FITC)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP76132_P050 Unconjugated

ARP76132_P050-HRP Conjugated

ARP76132_P050-Biotin Conjugated

Gene Symbol:
ERF
NCBI Gene Id:
2077
Swissprot Id:
P50548
Alias Symbols:
ERF,
Replacement Item:
This antibody may replace item sc-159761 from Santa Cruz Biotechnology.
Description of Target:
Members of the ETS family of transcription factors, such as ERF, regulate cell proliferation and differentiation. They share a highly conserved DNA-binding domain, the ETS domain, that recognizes the sequence GGAA/T (de Castro et al., 1997 [PubMed 9192842]). For further information on ETS transcription factors, see ETS1 (MIM 164720).
Protein Size (# AA):
548
Molecular Weight:
60kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express ERF.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express ERF.
Immunogen:
The immunogen is a synthetic peptide directed towards the C-terminal region of Human ERF
Predicted Species Reactivity:
Human
Peptide Sequence:
Synthetic peptide located within the following region: MPLKLRFKRRWSEDCRLEGGGGPAGGFEDEGEDKKVRGEGPGEAGGPLTP
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer.
Reconstitution and Storage:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Concentration:
0.5 mg/ml
Blocking Peptide:
For anti-ERF (ARP76132_P050-FITC) antibody is Catalog # AAP76132
Datasheets/Manuals:
Printable datasheet for anti-ERF (ARP76132_P050-FITC) antibody
Conjugation:
FITC (FAM): Excitation 495 nm/ Emission 520 nm
Target Reference:
N/A

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...