ERF Antibody - C-terminal region (ARP31651_P050)

Catalog No: ARP31651_P050

WB Suggested Anti-ERF Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:12500
Positive Control: Human brain

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Horse, Pig, Yeast, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human ERF
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rat: 100%; Yeast: 90%; Zebrafish: 93%
• Peptide Sequence: Synthetic peptide located within the following region: GGLAEGAGALAPPPPPPQIKVEPISEGESEEVEVTDISDEDEEDGEVFKT
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-ERF (ARP31651_P050) antibody is Catalog # AAP31651 (Previous Catalog # AAPP23925)
• Reference: Verykokakis,M., (2007) J. Biol. Chem. 282 (41), 30285-30294

Target Info

• Gene Symbol: ERF
• Gene Full Name: Ets2 repressor factor
• Alias Symbols: PE2, CRS4, PE-2, CHYTS
• NCBI Gene Id: 2077
• Protein Name: ETS domain-containing transcription factor ERF
• Description of Target: Members of the ETS family of transcription factors, such¡¡as ERF, regulate cell proliferation and differentiation. They share¡¡a highly conserved DNA-binding domain, the ETS domain, that¡¡recognizes the sequence GGAA/T.Members of the ETS family of transcription factors, such as ERF, regulate cell proliferation and differentiation. They share a highly conserved DNA-binding domain, the ETS domain, that recognizes the sequence GGAA/T (de Castro et al., 1997 [PubMed 9192842]). For further information on ETS transcription factors, see ETS1 (MIM 164720).[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-56 DC299706.1 1-56 57-2698 BC022231.1 1-2642 2699-2705 BM905776.1 207-213
• Uniprot ID: P50548
• Protein Accession #: NP_006485
• Nucleotide Accession #: NM_006494
• Protein Size (# AA): 548
• Molecular Weight: 59kDa
• Protein Interactions: UBC; PAXIP1; SUMO2; XPO1; EPHB2; CSNK1A1; MAPK1; HMGB1;