SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP58570_P050
Price: $0.00
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-ERCC8 (ARP58570_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human ERCC8
PurificationAffinity Purified
Peptide SequenceSynthetic peptide located within the following region: FQELYSGSRDCNILAWVPSLYEPVPDDDETTTKSQLNPAFEDAWSSSDEE
Concentration0.5 mg/ml
Blocking PeptideFor anti-ERCC8 (ARP58570_P050) antibody is Catalog # AAP58570 (Previous Catalog # AAPP35516)
Sample Type Confirmation

ERCC8 is supported by BioGPS gene expression data to be expressed in HepG2

ReferenceBethke,L., (2008) J. Natl. Cancer Inst. 100 (4), 270-276
Gene SymbolERCC8
Gene Full NameExcision repair cross-complementing rodent repair deficiency, complementation group 8
Alias SymbolsCSA, CKN1, UVSS2
NCBI Gene Id1161
Protein NameDNA excision repair protein ERCC-8
Description of TargetERCC8 is a WD repeat protein, which interacts with Cockayne syndrome type B (CSB) protein and with p44 protein, a subunit of the RNA polymerase II transcription factor IIH. Mutations in this gene have been identified in patients with hereditary disease Cockayne syndrome (CS). This gene encodes a WD repeat protein, which interacts with Cockayne syndrome type B (CSB) protein and with p44 protein, a subunit of the RNA polymerase II transcription factor IIH. Mutations in this gene have been identified in patients with hereditary disease Cockayne syndrome (CS). CS cells are abnormally sensitive to ultraviolet radiation and are defective in the repair of transcriptionally active genes.
Uniprot IDQ13216
Protein Accession #NP_000073
Nucleotide Accession #NM_000082
Protein Size (# AA)396
Molecular Weight44kDa
  1. What is the species homology for "ERCC8 Antibody - middle region (ARP58570_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human".

  2. How long will it take to receive "ERCC8 Antibody - middle region (ARP58570_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "ERCC8 Antibody - middle region (ARP58570_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact

  4. What are other names for "ERCC8 Antibody - middle region (ARP58570_P050)"?

    This target may also be called "CSA, CKN1, UVSS2" in publications.

  5. What is the shipping cost for "ERCC8 Antibody - middle region (ARP58570_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "ERCC8 Antibody - middle region (ARP58570_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "ERCC8 Antibody - middle region (ARP58570_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "44kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "ERCC8 Antibody - middle region (ARP58570_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "ERCC8"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "ERCC8"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "ERCC8"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "ERCC8"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "ERCC8"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "ERCC8"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:ERCC8 Antibody - middle region (ARP58570_P050)
Your Rating
We found other products you might like!