Search Antibody, Protein, and ELISA Kit Solutions

ERCC8 Antibody - C-terminal region : FITC (ARP72502_P050-FITC)

Click here to learn more about Aviva's By-Request Conjugation Service.
100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP72502_P050 Unconjugated

ARP72502_P050-HRP Conjugated

ARP72502_P050-Biotin Conjugated

Click here to learn more about Aviva's By-Request Conjugation Service.
Gene Symbol:
ERCC8
NCBI Gene Id:
1161
Swissprot Id:
Q13216
Protein Accession #:
NP_000073
Alias Symbols:
ERCC8, CKN1, CSA,
Description of Target:
This gene encodes a WD repeat protein, which interacts with Cockayne syndrome type B (CSB) protein and with p44 protein, a subunit of the RNA polymerase II transcription factor IIH. Mutations in this gene have been identified in patients with hereditary disease Cockayne syndrome (CS). CS cells are abnormally sensitive to ultraviolet radiation and are defective in the repair of transcriptionally active genes. Several transcript variants encoding different isoforms have been found for this gene.
Protein Size (# AA):
396
Molecular Weight:
43kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express ERCC8.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express ERCC8.
Immunogen:
The immunogen is a synthetic peptide directed towards the C-terminal region of Human ERCC8
Predicted Species Reactivity:
Human
Peptide Sequence:
Synthetic peptide located within the following region: QSNFQELYSGSRDCNILAWVPSLYEPVPDDDETTTKSQLNPAFEDAWSSS
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer.
Reconstitution and Storage:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Concentration:
1 mg/ml
Protein Interactions:
CUL4A; CUL4B; DDB1; RUVBL2; ZNF24; PCNA; H1F0; ERCC6; UVSSA; DDA1; RFWD2; COPS4; COPS6; COPS3; TOP1; TP53; SSBP1; OGG1; MDM2; GTF2H2; CUL5; GPS1; DDB2; COPS2; COPS7A; COPS5; COPS8; RBX1; POLR2A; HMGN1; EP300; UBC; CSNK2B; XAB2; UQCRQ; CBR1;
Blocking Peptide:
For anti-ERCC8 (ARP72502_P050-FITC) antibody is Catalog # AAP72502
Datasheets/Manuals:
Printable datasheet for anti-ERCC8 (ARP72502_P050-FITC) antibody
Conjugation:
FITC (FAM): Excitation 495 nm/ Emission 520 nm

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...