Size:100 ul
Special Price $229.00 Regular Price $289.00
In Stock
SKU
ARP37963_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP37963_P050-FITC Conjugated

ARP37963_P050-HRP Conjugated

ARP37963_P050-Biotin Conjugated

ERCC3 Antibody - N-terminal region (ARP37963_P050)

Catalog#: ARP37963_P050
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Guinea Pig, Human, Pig, Rabbit, Rat, Yeast, Zebrafish
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-124011 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human ERCC3
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 86%; Dog: 86%; Guinea Pig: 79%; Human: 100%; Pig: 93%; Rabbit: 79%; Rat: 79%; Yeast: 90%; Zebrafish: 79%
Complete computational species homology data Anti-ERCC3 (ARP37963_P050)
Peptide Sequence Synthetic peptide located within the following region: MGKRDRADRDKKKSRKRHYEDEEDDEEDAPGNDPQEAVPSAAGKQVDESG
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-ERCC3 (ARP37963_P050) antibody is Catalog # AAP37963 (Previous Catalog # AAPP23267)
Datasheets/Manuals Printable datasheet for anti-ERCC3 (ARP37963_P050) antibody
Sample Type Confirmation

ERCC3 is supported by BioGPS gene expression data to be expressed in HCT15

Publications

Vijai, J; Topka, S; Villano, D; Ravichandran, V; Maxwell, KN; Maria, A; Thomas, T; Gaddam, P; Lincoln, A; Kazzaz, S; Wenz, B; Carmi, S; Schrader, KA; Hart, SN; Lipkin, SM; Neuhausen, SL; Walsh, MF; Zhang, L; Lejbkowicz, F; Rennert, H; Stadler, ZK; Robson, M; Weitzel, JN; Domchek, S; Daly, MJ; Couch, FJ; Nathanson, KL; Norton, L; Rennert, G; Offit, K; A Recurrent ERCC3 Truncating Mutation Confers Moderate Risk for Breast Cancer. 6, 1267-1275 (2016). WB, Cow, Dog, Guinea Pig, Human, Pig, Rabbit, Rat, Yeast, Zebrafish 27655433

Gene Symbol ERCC3
Official Gene Full Name Excision repair cross-complementing rodent repair deficiency, complementation group 3
Alias Symbols BTF2, GTF2H, RAD25, TFIIH, XPB
NCBI Gene Id 2071
Protein Name TFIIH basal transcription factor complex helicase XPB subunit
Description of Target ERCC3 is an ATP-dependent DNA helicase that functions in nucleotide excision repair and complements xeroderma pigmentosum group B mutations. It also is the 89 kDa subunit of basal transcription factor 2 (TFIIH) and thus functions in class II transcription.
Swissprot Id P19447
Protein Accession # NP_000113
Nucleotide Accession # NM_000122
Protein Size (# AA) 782
Molecular Weight 89kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express ERCC3.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express ERCC3.
Protein Interactions XIAP; CEP70; UBC; rev; SRPK2; CDK7; TP53; E2F1; CDK8; CCNC; GTF2H5; ERCC2; MSANTD2; UVSSA; POLR2C; KPNA3; RAD52; MMS19; SIX5; GTF2H4; GTF2H3; GTF2H1; tat; COPS2; GTF2H2; NEDD8; ERCC6; POLR2A; AR; CCNH; MYC; MNAT1; ZSCAN1; ATF7IP; GCN1L1; ERCC5; BCR; PSMC5
  1. What is the species homology for "ERCC3 Antibody - N-terminal region (ARP37963_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Cow, Dog, Guinea Pig, Human, Pig, Rabbit, Rat, Yeast, Zebrafish".

  2. How long will it take to receive "ERCC3 Antibody - N-terminal region (ARP37963_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "ERCC3 Antibody - N-terminal region (ARP37963_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "ERCC3 Antibody - N-terminal region (ARP37963_P050)"?

    This target may also be called "BTF2, GTF2H, RAD25, TFIIH, XPB" in publications.

  5. What is the shipping cost for "ERCC3 Antibody - N-terminal region (ARP37963_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "ERCC3 Antibody - N-terminal region (ARP37963_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "ERCC3 Antibody - N-terminal region (ARP37963_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "89kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "ERCC3 Antibody - N-terminal region (ARP37963_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "ERCC3"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "ERCC3"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "ERCC3"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "ERCC3"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "ERCC3"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "ERCC3"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:ERCC3 Antibody - N-terminal region (ARP37963_P050)
Your Rating
We found other products you might like!