Search Antibody, Protein, and ELISA Kit Solutions

ERCC3 Antibody - N-terminal region (ARP37963_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP37963_P050-FITC Conjugated

ARP37963_P050-HRP Conjugated

ARP37963_P050-Biotin Conjugated

Gene Symbol:
ERCC3
Official Gene Full Name:
Excision repair cross-complementing rodent repair deficiency, complementation group 3
NCBI Gene Id:
2071
Protein Name:
TFIIH basal transcription factor complex helicase XPB subunit
Swissprot Id:
P19447
Protein Accession #:
NP_000113
Nucleotide Accession #:
NM_000122
Alias Symbols:
BTF2, GTF2H, RAD25, TFIIH, XPB
Replacement Item:
This antibody may replace item sc-124011 from Santa Cruz Biotechnology.
Description of Target:
ERCC3 is an ATP-dependent DNA helicase that functions in nucleotide excision repair and complements xeroderma pigmentosum group B mutations. It also is the 89 kDa subunit of basal transcription factor 2 (TFIIH) and thus functions in class II transcription.
Protein Size (# AA):
782
Molecular Weight:
89kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express ERCC3.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express ERCC3.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human ERCC3
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Human, Pig, Rabbit, Rat, Yeast, Zebrafish
Tested Species Reactivity:
Human
Predicted Homology Based on Immunogen Sequence:
Cow: 86%; Dog: 86%; Guinea Pig: 79%; Human: 100%; Pig: 93%; Rabbit: 79%; Rat: 79%; Yeast: 90%; Zebrafish: 79%
Complete computational species homology data:
Anti-ERCC3 (ARP37963_P050)
Peptide Sequence:
Synthetic peptide located within the following region: MGKRDRADRDKKKSRKRHYEDEEDDEEDAPGNDPQEAVPSAAGKQVDESG
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
XIAP; CEP70; UBC; rev; SRPK2; CDK7; TP53; E2F1; CDK8; CCNC; GTF2H5; ERCC2; MSANTD2; UVSSA; POLR2C; KPNA3; RAD52; MMS19; SIX5; GTF2H4; GTF2H3; GTF2H1; tat; COPS2; GTF2H2; NEDD8; ERCC6; POLR2A; AR; CCNH; MYC; MNAT1; ZSCAN1; ATF7IP; GCN1L1; ERCC5; BCR; PSMC5
Blocking Peptide:
For anti-ERCC3 (ARP37963_P050) antibody is Catalog # AAP37963 (Previous Catalog # AAPP23267)
Datasheets/Manuals:
Printable datasheet for anti-ERCC3 (ARP37963_P050) antibody
Sample Type Confirmation:

ERCC3 is supported by BioGPS gene expression data to be expressed in HCT15

Publications:

Vijai, J; Topka, S; Villano, D; Ravichandran, V; Maxwell, KN; Maria, A; Thomas, T; Gaddam, P; Lincoln, A; Kazzaz, S; Wenz, B; Carmi, S; Schrader, KA; Hart, SN; Lipkin, SM; Neuhausen, SL; Walsh, MF; Zhang, L; Lejbkowicz, F; Rennert, H; Stadler, ZK; Robson, M; Weitzel, JN; Domchek, S; Daly, MJ; Couch, FJ; Nathanson, KL; Norton, L; Rennert, G; Offit, K; A Recurrent ERCC3 Truncating Mutation Confers Moderate Risk for Breast Cancer. 6, 1267-1275 (2016). WB, Cow, Dog, Guinea Pig, Human, Pig, Rabbit, Rat, Yeast, Zebrafish 27655433

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...