Search Antibody, Protein, and ELISA Kit Solutions

ERCC3 Antibody - N-terminal region (ARP37963_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP37963_P050-FITC Conjugated

ARP37963_P050-HRP Conjugated

ARP37963_P050-Biotin Conjugated

Tested Species Reactivity:
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Human, Pig, Rabbit, Rat, Yeast, Zebrafish
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
Official Gene Full Name:
Excision repair cross-complementing rodent repair deficiency, complementation group 3
NCBI Gene Id:
Protein Name:
TFIIH basal transcription factor complex helicase XPB subunit
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Replacement Item:
This antibody may replace item sc-124011 from Santa Cruz Biotechnology.
Description of Target:
ERCC3 is an ATP-dependent DNA helicase that functions in nucleotide excision repair and complements xeroderma pigmentosum group B mutations. It also is the 89 kDa subunit of basal transcription factor 2 (TFIIH) and thus functions in class II transcription.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express ERCC3.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express ERCC3.
The immunogen is a synthetic peptide directed towards the N terminal region of human ERCC3
Predicted Homology Based on Immunogen Sequence:
Cow: 86%; Dog: 86%; Guinea Pig: 79%; Human: 100%; Pig: 93%; Rabbit: 79%; Rat: 79%; Yeast: 90%; Zebrafish: 79%
Complete computational species homology data:
Anti-ERCC3 (ARP37963_P050)
Peptide Sequence:
Synthetic peptide located within the following region: MGKRDRADRDKKKSRKRHYEDEEDDEEDAPGNDPQEAVPSAAGKQVDESG
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-ERCC3 (ARP37963_P050) antibody is Catalog # AAP37963 (Previous Catalog # AAPP23267)
Printable datasheet for anti-ERCC3 (ARP37963_P050) antibody
Sample Type Confirmation:

ERCC3 is supported by BioGPS gene expression data to be expressed in HCT15


Vijai, J; Topka, S; Villano, D; Ravichandran, V; Maxwell, KN; Maria, A; Thomas, T; Gaddam, P; Lincoln, A; Kazzaz, S; Wenz, B; Carmi, S; Schrader, KA; Hart, SN; Lipkin, SM; Neuhausen, SL; Walsh, MF; Zhang, L; Lejbkowicz, F; Rennert, H; Stadler, ZK; Robson, M; Weitzel, JN; Domchek, S; Daly, MJ; Couch, FJ; Nathanson, KL; Norton, L; Rennert, G; Offit, K; A Recurrent ERCC3 Truncating Mutation Confers Moderate Risk for Breast Cancer. 6, 1267-1275 (2016). WB, Cow, Dog, Guinea Pig, Human, Pig, Rabbit, Rat, Yeast, Zebrafish 27655433

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...