Aviva Systems Biology will be closed in observance of Good Friday 3/29/2024. If you are in need of any assistance please email info@avivasysbio.com

Catalog No: P100701_P050-HRP
Size:100ul
Price: $434.00
SKU
P100701_P050-HRP
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.

ERCC2 Antibody - N-terminal region : HRP (P100701_P050-HRP)

Datasheets/ManualsPrintable datasheet for anti-ERCC2 (P100701_P050-HRP) antibody
Product Info
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Guinea Pig, Zebrafish
Product FormatLiquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
ClonalityPolyclonal
HostRabbit
ConjugationHRP: Horseradish Peroxidase
ApplicationWB
Reconstitution and StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human ERCC2
Predicted Homology Based on Immunogen SequenceCow: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Zebrafish: 100%
Peptide SequenceSynthetic peptide located within the following region: KLNVDGLLVYFPYDYIYPEQFSYMRELKRTLDAKGHGVLEMPSGTGKTVS
Concentration0.5 mg/ml
Blocking PeptideFor anti-ERCC2 (P100701_P050-HRP) antibody is Catalog # AAP31053 (Previous Catalog # AAPP01787)
ReferenceBraun,M.S., (2008) J. Clin. Oncol. 26 (16), 2690-2698
Gene SymbolERCC2
Gene Full NameExcision repair cross-complementing rodent repair deficiency, complementation group 2
Alias SymbolsEM9, TTD, XPD, TTD1, COFS2, TFIIH
NCBI Gene Id2068
Protein NameTFIIH basal transcription factor complex helicase XPD subunit
Description of TargetThe nucleotide excision repair pathway is a mechanism to repair damage to DNA. ERCC2 is involved in transcription-coupled nucleotide excision repair and is an integral member of the basal transcription factor BTF2/TFIIH complex. This protein has ATP-dependent DNA helicase activity and belongs to the RAD3/XPD subfamily of helicases. Defects in this gene can result in three different disorders, the cancer-prone syndrome xeroderma pigmentosum complementation group D, trichothiodystrophy, and Cockayne syndrome. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. The nucleotide excision repair pathway is a mechanism to repair damage to DNA. The protein encoded by this gene is involved in transcription-coupled nucleotide excision repair and is an integral member of the basal transcription factor BTF2/TFIIH complex. The gene product has ATP-dependent DNA helicase activity and belongs to the RAD3/XPD subfamily of helicases. Defects in this gene can result in three different disorders, the cancer-prone syndrome xeroderma pigmentosum complementation group D, trichothiodystrophy, and Cockayne syndrome. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Uniprot IDP18074
Protein Accession #NP_000391
Nucleotide Accession #NM_000400
Protein Size (# AA)760
Molecular Weight87kDa
Protein InteractionsGTF2H2C_2; UBC; FAM96B; CIAO1; rev; CDK7; TP53; MMS19; ERCC3; UVSSA; RAD52; GTF2H1; MNAT1; CCNH; GTF2F1; PIDD1; GTF2H3; GTF2H2; AR; ERCC6; tat; ATF7IP; HERC5; ISG15; TRIM25; RAD51; ERCC5; ERCC2; CDK1;
  1. What is the species homology for "ERCC2 Antibody - N-terminal region : HRP (P100701_P050-HRP)"?

    The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Guinea Pig, Zebrafish".

  2. How long will it take to receive "ERCC2 Antibody - N-terminal region : HRP (P100701_P050-HRP)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "ERCC2 Antibody - N-terminal region : HRP (P100701_P050-HRP)" provided in?

    This item is provided in "Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "ERCC2 Antibody - N-terminal region : HRP (P100701_P050-HRP)"?

    This target may also be called "EM9, TTD, XPD, TTD1, COFS2, TFIIH" in publications.

  5. What is the shipping cost for "ERCC2 Antibody - N-terminal region : HRP (P100701_P050-HRP)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "ERCC2 Antibody - N-terminal region : HRP (P100701_P050-HRP)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "ERCC2 Antibody - N-terminal region : HRP (P100701_P050-HRP)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "87kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "ERCC2 Antibody - N-terminal region : HRP (P100701_P050-HRP)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "ERCC2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "ERCC2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "ERCC2"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "ERCC2"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "ERCC2"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "ERCC2"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:ERCC2 Antibody - N-terminal region : HRP (P100701_P050-HRP)
Your Rating
We found other products you might like!