Aviva Systems Biology will be closed in observance of Good Friday 3/29/2024. If you are in need of any assistance please email info@avivasysbio.com

Catalog No: ARP30252_P050-Biotin
Size:100ul
Price: $434.00
SKU
ARP30252_P050-Biotin
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.

ERBB3 Antibody : Biotin (ARP30252_P050-Biotin)

Datasheets/ManualsPrintable datasheet for anti-ERBB3 (ARP30252_P050-Biotin) antibody
Product Info
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Guinea Pig, Horse
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer.
ClonalityPolyclonal
HostRabbit
ConjugationBiotin
ApplicationIHC
Reconstitution and StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
ImmunogenThe immunogen is a synthetic peptide directed towards the following sequence GLLFSLARGSEVGNSQAVCPGTLNGLSVTGDAENQYQTLYKLYERCEVVM
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 92%; Guinea Pig: 100%; Horse: 92%; Human: 100%; Mouse: 92%; Rat: 92%
Peptide SequenceSynthetic peptide located within the following region: GLLFSLARGSEVGNSQAVCPGTLNGLSVTGDAENQYQTLYKLYERCEVVM
Concentration0.5 mg/ml
Blocking PeptideAvailable upon request
Gene SymbolERBB3
Gene Full Namev-erb-b2 erythroblastic leukemia viral oncogene homolog 3 (avian)
Alias SymbolsHER3, FERLK, LCCS2, ErbB-3, c-erbB3, erbB3-S, MDA-BF-1, c-erbB-3, p180-ErbB3, p45-sErbB3, p85-sErbB3
NCBI Gene Id2065
Protein NameReceptor tyrosine-protein kinase erbB-3
Description of TargetThis gene encodes a member of the epidermal growth factor receptor (EGFR) family of receptor tyrosine kinases. This membrane-bound protein has a neuregulin binding domain but not an active kinase domain. It therefore can bind this ligand but not convey the signal into the cell through protein phosphorylation. However, it does form heterodimers with other EGF receptor family members which do have kinase activity. Heterodimerization leads to the activation of pathways which lead to cell proliferation or differentiation. Amplification of this gene and/or overexpression of its protein have been reported in numerous cancers, including prostate, bladder, and breast tumors. Alternate transcriptional splice variants encoding different isoforms have been characterized. One isoform lacks the intermembrane region and is secreted outside the cell. This form acts to modulate the activity of the membrane-bound form. Additional splice variants have also been reported, but they have not been thoroughly characterized.
Uniprot IDP21860
Protein Accession #NP_001973
Nucleotide Accession #NM_001005915
Protein Size (# AA)1,342
Molecular Weight148 kDa
Protein InteractionsPA2G4; UBC; NEDD4; JAK3; JAK2; ITK; HSP90AA1; HCK; GRB7; FGFR1; FER; PIK3R2; PIK3R1; NCK1; SH2D1A; TNS4; TNS3; SHC3; DAPP1; TENC1; VAV3; SH2B3; RIN1; PIK3R3; NCK2; BCAR3; ZAP70; VAV2; VAV1; TXK; SYK; SRC; SHC1; RASA1; PTK6; PLCG1; DAB1; CRKL; CRK; CHN2; A
  1. What is the species homology for "ERBB3 Antibody : Biotin (ARP30252_P050-Biotin)"?

    The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Guinea Pig, Horse".

  2. How long will it take to receive "ERBB3 Antibody : Biotin (ARP30252_P050-Biotin)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "ERBB3 Antibody : Biotin (ARP30252_P050-Biotin)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "ERBB3 Antibody : Biotin (ARP30252_P050-Biotin)"?

    This target may also be called "HER3, FERLK, LCCS2, ErbB-3, c-erbB3, erbB3-S, MDA-BF-1, c-erbB-3, p180-ErbB3, p45-sErbB3, p85-sErbB3" in publications.

  5. What is the shipping cost for "ERBB3 Antibody : Biotin (ARP30252_P050-Biotin)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "ERBB3 Antibody : Biotin (ARP30252_P050-Biotin)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "ERBB3 Antibody : Biotin (ARP30252_P050-Biotin)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "148 kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "ERBB3 Antibody : Biotin (ARP30252_P050-Biotin)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "ERBB3"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "ERBB3"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "ERBB3"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "ERBB3"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "ERBB3"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "ERBB3"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:ERBB3 Antibody : Biotin (ARP30252_P050-Biotin)
Your Rating
We found other products you might like!