Search Antibody, Protein, and ELISA Kit Solutions

ERBB2 Antibody - Middle region (ARP10187_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP10187_P050-FITC Conjugated

ARP10187_P050-HRP Conjugated

ARP10187_P050-Biotin Conjugated

Gene Symbol:
ERBB2
NCBI Gene Id:
13866
Swissprot Id:
P70424
Protein Accession #:
NP_001003817.1
Alias Symbols:
Kiaa3023, Neu
Replacement Item:
This antibody may replace item sc-08 from Santa Cruz Biotechnology.
Description of Target:
Essential component of a neuregulin-receptor complex, although neuregulins do not interact with it alone. GP30 is a potential ligand for this receptor. Binds to the 5'-TCAAATTC-3' sequence in the MT-CO2 promoter and activates its transcription (By similarity).
Protein Size (# AA):
1256
Molecular Weight:
138 kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express ERBB2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express ERBB2.
Immunogen:
The immunogen is a synthetic peptide directed towards the Middle region of Mouse ERBB2
Tested Species Reactivity:
Human, Mouse
Peptide Sequence:
Synthetic peptide located within the following region: FSRMARDPQRFVVIQNEDLGPSSPMDSTFY
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Blocking Peptide:
For anti-ERBB2 (ARP10187_P050) antibody is Catalog # AAP10187
Datasheets/Manuals:
Printable datasheet for anti-ERBB2 (ARP10187_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...