Catalog No: ARP54726_P050
Price: $0.00
SKU
ARP54726_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-EPS8 (ARP54726_P050) antibody
Product Info
ReferenceWelsch,T., (2007) Cancer Lett. 255 (2), 205-218
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB, IHC
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human EPS8
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 93%; Horse: 93%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 93%; Rat: 93%
Peptide SequenceSynthetic peptide located within the following region: VSKVPANITRQNSSSSDSGGSIVRDSQRHKQLPVDRRKSQMEEVQDELIH
Concentration0.5 mg/ml
Blocking PeptideFor anti-EPS8 (ARP54726_P050) antibody is Catalog # AAP54726 (Previous Catalog # AAPP31521)
Sample Type Confirmation

EPS8 is supported by BioGPS gene expression data to be expressed in ACHN

Gene SymbolEPS8
Gene Full NameEpidermal growth factor receptor pathway substrate 8
Alias SymbolsDFNB102
NCBI Gene Id2059
Protein NameEpidermal growth factor receptor kinase substrate 8
Description of TargetThis gene encodes a member of the EPS8 family. This protein contains one PH domain and one SH3 domain. It functions as part of the EGFR pathway, though its exact role has not been determined. Highly similar proteins in other organisms are involved in the
Uniprot IDQ12929
Protein Accession #NP_004438
Nucleotide Accession #NM_004447
Protein Size (# AA)822
Molecular Weight92kDa
Protein InteractionsGRB2; RUNX1T1; BYSL; GOLGA8EP; C19orf25; C17orf59; INPP5J; BAIAP2; SMARCE1; HNRNPC; SUMO2; BAIAP2L1; ANKRD28; EPS8; SOX2; TPRN; PROSER2; NACC2; SCRN3; ARMC1; ADAM22; TDP2; GULP1; CTNNA3; ZZZ3; SF3B3; SLC27A4; BCKDK; RFXAP; NFKB2; MAP3K11; CXCL2; XRCC6; CS
  1. What is the species homology for "EPS8 Antibody - middle region (ARP54726_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit".

  2. How long will it take to receive "EPS8 Antibody - middle region (ARP54726_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "EPS8 Antibody - middle region (ARP54726_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "EPS8 Antibody - middle region (ARP54726_P050)"?

    This target may also be called "DFNB102" in publications.

  5. What is the shipping cost for "EPS8 Antibody - middle region (ARP54726_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "EPS8 Antibody - middle region (ARP54726_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "EPS8 Antibody - middle region (ARP54726_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "92kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "EPS8 Antibody - middle region (ARP54726_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "EPS8"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "EPS8"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "EPS8"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "EPS8"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "EPS8"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "EPS8"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:EPS8 Antibody - middle region (ARP54726_P050)
Your Rating
We found other products you might like!