Search Antibody, Protein, and ELISA Kit Solutions

EPS15 Antibody - C-terminal region (ARP97795_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Gene Symbol:
EPS15
Official Gene Full Name:
epidermal growth factor receptor pathway substrate 15
NCBI Gene Id:
2060
Protein Name:
epidermal growth factor receptor substrate 15
Swissprot Id:
P42566-2
Protein Accession #:
NP_001153441.1
Nucleotide Accession #:
NM_001159969.1
Alias Symbols:
AF1P, AF-1P, MLLT5
Description of Target:
This gene encodes a protein that is part of the EGFR pathway. The protein is present at clatherin-coated pits and is involved in receptor-mediated endocytosis of EGF. Notably, this gene is rearranged with the HRX/ALL/MLL gene in acute myelogeneous leukemias. Alternative splicing results in multiple transcript variants encoding distinct isoforms.
Protein Size (# AA):
582
Molecular Weight:
64 kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express EPS15.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express EPS15.
Immunogen:
The immunogen is a synthetic peptide directed towards the C terminal region of human EPS15
Predicted Species Reactivity:
Human
Tested Species Reactivity:
Human
Peptide Sequence:
Synthetic peptide located within the following region: KLNDPFQPFPGNDSPKEKDPEIFCDPFTSATTTTNKEADPSNFANFSAYP
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-EPS15 (ARP97795_P050) antibody is Catalog # AAP97795
Datasheets/Manuals:
Printable datasheet for anti-EPS15 (ARP97795_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...