Search Antibody, Protein, and ELISA Kit Solutions

EPOR Antibody - N-terminal region (ARP44216_P050)

100 ul
$319.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP44216_P050-FITC Conjugated

ARP44216_P050-HRP Conjugated

ARP44216_P050-Biotin Conjugated

Tested Species Reactivity:
Human, Mouse
Predicted Species Reactivity:
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rat
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality:
Polyclonal
Host:
Rabbit
Application:
WB
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
EPOR
Official Gene Full Name:
Erythropoietin receptor
NCBI Gene Id:
2057
Protein Name:
Erythropoietin receptor
Swissprot Id:
P19235
Protein Accession #:
NP_000112
Nucleotide Accession #:
NM_000121
Alias Symbols:
MGC138358, EPO-R
Replacement Item:
This antibody may replace item sc-365662 from Santa Cruz Biotechnology.
Description of Target:
The erythropoietin receptor is a member of the cytokine receptor family. Upon erythropoietin binding, the erythropoietin receptor activates Jak2 tyrosine kinase which activates different intracellular pathways including: Ras/MAP kinase, phosphatidylinositol 3-kinase and STAT transcription factors. The stimulated erythropoietin receptor appears to have a role in erythroid cell survival. Defects in the erythropoietin receptor may produce erythroleukemia and familial erythrocytosis.The erythropoietin receptor is a member of the cytokine receptor family. Upon erythropoietin binding, the erythropoietin receptor activates Jak2 tyrosine kinase which activates different intracellular pathways including: Ras/MAP kinase, phosphatidylinositol 3-kinase and STAT transcription factors. The stimulated erythropoietin receptor appears to have a role in erythroid cell survival. Defects in the erythropoietin receptor may produce erythroleukemia and familial erythrocytosis. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Protein Size (# AA):
508
Molecular Weight:
53kDa
Purification:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express EPOR.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express EPOR.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human EPOR
Predicted Homology Based on Immunogen Sequence:
Cow: 85%; Dog: 100%; Goat: 91%; Guinea Pig: 93%; Horse: 92%; Human: 100%; Mouse: 100%; Rat: 100%
Complete computational species homology data:
Anti-EPOR (ARP44216_P050)
Peptide Sequence:
Synthetic peptide located within the following region: DHLGASLWPQVGSLCLLLAGAAWAPPPNLPDPKFESKAALLAARGPEELL
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
PIK3R1; SRC; MST1R; JAK2; SH2B2; STAT5A; CBL; CRKL; GRB2; UBC; SOCS2; PLCG1; INPP5D; CISH; NOSIP; ATXN2L; GAB2; GAB1; GRAP; STAT5B; SOCS3; MAPK3; IRS2; SHC1; PLCG2; SYK; KITLG; GNB2L1; MAPK1; PTPN6; PTPN11; KLK3; LYN; KIT; VAV1; GNAI1; CSF2RB; EPOR; EPO;
Blocking Peptide:
For anti-EPOR (ARP44216_P050) antibody is Catalog # AAP44216 (Previous Catalog # AAPP11992)
Datasheets/Manuals:
Printable datasheet for anti-EPOR (ARP44216_P050) antibody
Target Reference:
Sinclair,A.M., (2008) Br. J. Cancer 98 (6), 1059-1067

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...