EPO Recombinant Protein (Pig) (OPCA05076)

Catalog No: OPCA05076

Product Info

• Predicted Species Reactivity: Porcine|Sus scrofa
• Product Format: Liquid or Lyophilized powder
• Additional Information: Species Specificity Detail: Sus scrofa (Pig)
• Reconstitution and Storage: -20°C or -80°C
• Formulation: Tris-base, 50% glycerol
• Purity: Greater than 90% as determined by SDS-PAGE.
• Peptide Sequence: APPRLICDSRVLERYILEAKEGENATMGCAESCSFSENITVPDTKVNFYAWKRMEVQQQAMEVWQGLALLSEAILQGQALLANSSQPSEALQLHVDKAVSGLRSLTSLLRALGAQKEAIPLPDASPSSATPLRTFAVDTLCKLFRNYSNFLRGKLTLYTGEACRRRDR
• Protein Sequence: APPRLICDSRVLERYILEAKEGENATMGCAESCSFSENITVPDTKVNFYAWKRMEVQQQAMEVWQGLALLSEAILQGQALLANSSQPSEALQLHVDKAVSGLRSLTSLLRALGAQKEAIPLPDASPSSATPLRTFAVDTLCKLFRNYSNFLRGKLTLYTGEACRRRDR
• Storage Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: E.coli
• Protein Range: 27-194 aa
• Tag: N-terminal 6xHis-B2M-tagged

Target Info

• Reference: The porcine erythropoietin gene: cDNA sequence, genomic sequence and expression analyses in piglets. David R.B., Blom A.K., Sjaastad O.V., Harbitz I. Domest. Anim. Endocrinol. 20:137-147(2001)
• Gene Symbol: EPO
• Gene Full Name: erythropoietin
• Alias Symbols: erythropoietin.
• NCBI Gene Id: 397249
• Protein Name: Erythropoietin
• Description of Target: Hormone involved in the regulation of erythrocyte proliferation and differentiation and the maintenance of a physiological level of circulating erythrocyte mass. Binds to EPOR leading to EPOR dimerization and JAK2 activation thereby activating specific downstream effectors, including STAT1 and STAT3.
• Uniprot ID: P49157
• Protein Accession #: NP_999299
• Nucleotide Accession #: NM_214134
• Protein Size (# AA): Recombinant
• Molecular Weight: 32.6 kDa