EPN2 Antibody - middle region (ARP55480_P050)

Catalog No: ARP55480_P050

WB Suggested Anti-EPN2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Human brain

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human EPN2
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 93%; Dog: 100%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
• Peptide Sequence: Synthetic peptide located within the following region: DPFESQPLTVASSKPSSARKTPESFLGPNAALVNLDSLVTRPAPPAQSLN
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-EPN2 (ARP55480_P050) antibody is Catalog # AAP55480 (Previous Catalog # AAPP33372)

Target Info

• Reference: Olsen,J.V., (2006) Cell 127 (3), 635-648
• Gene Symbol: EPN2
• Gene Full Name: Epsin 2
• Alias Symbols: EHB21
• NCBI Gene Id: 22905
• Protein Name: Epsin 2 EMBL AAH93974.1
• Description of Target: EPN2 is a protein which interacts with clathrin and adaptor-related protein complex 2, alpha 1 subunit. The protein is found in a brain-derived clathrin-coated vesicle fraction and localizes to the peri-Golgi region and the cell periphery. The protein is thought to be involved in clathrin-mediated endocytosis.This gene encodes a protein which interacts with clathrin and adaptor-related protein complex 2, alpha 1 subunit. The protein is found in a brain-derived clathrin-coated vesicle fraction and localizes to the peri-Golgi region and the cell periphery. The protein is thought to be involved in clathrin-mediated endocytosis. Alternate splicing of this gene results in multiple transcript variants encoding different isoforms.
• Uniprot ID: Q52LD0
• Protein Accession #: NP_683723
• Nucleotide Accession #: NM_148921
• Protein Size (# AA): 584
• Molecular Weight: 62kDa
• Protein Interactions: rev; UBC; APOE; UBQLN2; ITSN1; RNF11; EPS15; YWHAG; TUBA1B; LAPTM5; CLTC; TFAP2A; Eps15l1;