Catalog No: ARP54286_P050
Price: $0.00
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.

EPHX1 Antibody - middle region (ARP54286_P050)

Datasheets/ManualsPrintable datasheet for anti-EPHX1 (ARP54286_P050) antibody
Product Info
ReferenceLuo,B., (2008) J. Mol. Biol. 380 (1), 31-41
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human EPHX1
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 93%; Dog: 93%; Goat: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%; Zebrafish: 93%
Peptide SequenceSynthetic peptide located within the following region: CPSIPGYGFSEASSKKGFNSVATARIFYKLMLRLGFQEFYIQGGDWGSLI
Concentration0.5 mg/ml
Blocking PeptideFor anti-EPHX1 (ARP54286_P050) antibody is Catalog # AAP54286 (Previous Catalog # AAPP31035)
Gene SymbolEPHX1
Gene Full NameEpoxide hydrolase 1, microsomal (xenobiotic)
Alias SymbolsMEH, EPHX, EPOX, HYL1
NCBI Gene Id2052
Protein NameEpoxide hydrolase 1
Description of TargetEpoxide hydrolase is a critical biotransformation enzyme that converts epoxides from the degradation of aromatic compounds to trans-dihydrodiols which can be conjugated and excreted from the body. Epoxide hydrolase functions in both the activation and detoxification of epoxides. Mutations in this gene cause preeclampsia, epoxide hydrolase deficiency or increased epoxide hydrolase activity. Epoxide hydrolase plays an important role in both the activation and detoxification of exogenous chemicals such as polycyclic aromatic hydrocarbons. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Uniprot IDP07099
Protein Accession #NP_000111
Nucleotide Accession #NM_000120
Protein Size (# AA)455
Molecular Weight53kDa
Protein InteractionsRNF2; ATP4A; UBC; HPDL; CDKN2AIP; DNAJB11; SUMO1;
  1. What is the species homology for "EPHX1 Antibody - middle region (ARP54286_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit, Zebrafish".

  2. How long will it take to receive "EPHX1 Antibody - middle region (ARP54286_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "EPHX1 Antibody - middle region (ARP54286_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact

  4. What are other names for "EPHX1 Antibody - middle region (ARP54286_P050)"?

    This target may also be called "MEH, EPHX, EPOX, HYL1" in publications.

  5. What is the shipping cost for "EPHX1 Antibody - middle region (ARP54286_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "EPHX1 Antibody - middle region (ARP54286_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "EPHX1 Antibody - middle region (ARP54286_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "53kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "EPHX1 Antibody - middle region (ARP54286_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "EPHX1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "EPHX1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "EPHX1"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "EPHX1"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "EPHX1"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "EPHX1"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:EPHX1 Antibody - middle region (ARP54286_P050)
Your Rating
We found other products you might like!