EPHB1/2 Antibody (Phospho-Tyr594/604) (OAAF07552)

Catalog No: OAAF07552 (Formerly GWB-ASB418)

Size:100 ug

Western blot analysis of lysates from HepG2 cells, using EPHB1/2 (Phospho-Tyr594/604) Antibody. The lane on the right is blocked with the phospho peptide.

Immunofluorescence analysis of HUVEC cells, using EPHB1/2 (Phospho-Tyr594/604) Antibody. The picture on the right is blocked with the phospho peptide.

Product Info

• Predicted Species Reactivity: Human|Mouse|Rat
• Clonality: Polyclonal
• Host: Rabbit
• Application: Enzyme-linked immunosorbent assay|Immunocytochemistry|Immunofluorescence|Western blot
• Additional Information: Modification Sites: Human:Y594/Y596 Mouse:Y594/Y604 Rat:Y594/-
• Reconstitution and Storage: -20°C
• Immunogen: The antiserum was produced against synthesized peptide derived from human EPHB1/2 around the phosphorylation site of Tyr594/604.
• Purification: The antibody was purified from rabbit antiserum by affinity-chromatography using phospho peptide. The antibody against non-phospho peptide was removed by chromatography using corresponding non-phospho peptide.
• Peptide Sequence: Synthetic peptide located within the following region: IVCSRKRAYSKEAVYSDKLQHYSTGRGSPGMKIYIDPFTYEDPNEAVREF
• Concentration: 1mg/ml
• Specificity: EPHB1/2 (Phospho-Tyr594/604) Antibody detects endogenous levels of EPHB1/2 only when phosphorylated at Tyr594/604.
• Formulation: Rabbit IgG in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol.
• Application Info: WB: 1:500~1:1000
  IF: 1:100~1:500
  ELISA: 1:1000

Target Info

• Gene Symbol: EPHA2|EPHB1|EPHB2
• Gene Full Name: EPH receptor A2|EPH receptor B1|EPH receptor B2
• Alias Symbols: ARCC2;BDPLT22;CAPB;CTPA;CTPP1;CTRCT6;developmentally-regulated Eph-related tyrosine kinase;DRT;ECK;EK5;EK6;ELK;elk-related tyrosine kinase;eph tyrosine kinase 2;eph tyrosine kinase 3;EPH-like kinase 5;EPH-like kinase 6;ephrin type-A receptor 2;ephrin type-B receptor 1;ephrin type-B receptor 2;EPHT2;EPHT3;Epithelial cell kinase;epithelial cell receptor protein tyrosine kinase;ERK;Hek5;Hek6;NET;neuronally-expressed EPH-related tyrosine kinase;PCBC;protein-tyrosine kinase HEK5;renal carcinoma antigen NY-REN-47;soluble EPHA2 variant 1;soluble EPHB1 variant 1;Tyro5;tyrosine-protein kinase receptor ECK;tyrosine-protein kinase receptor EPH-2;tyrosine-protein kinase receptor EPH-3;tyrosine-protein kinase TYRO5.
• NCBI Gene Id: 1969|2047|2048
• Protein Name: Ephrin type-A receptor 2|Ephrin type-B receptor 1|Ephrin type-B receptor 2
• Description of Target: Receptor tyrosine kinase which binds promiscuously membrane-bound ephrin-A family ligands residing on adjacent cells, leading to contact-dependent bidirectional signaling into neighboring cells. The signaling pathway downstream of the receptor is referred to as forward signaling while the signaling pathway downstream of the ephrin ligand is referred to as reverse signaling. Activated by the ligand ephrin-A1/EFNA1 regulates migration, integrin-mediated adhesion, proliferation and differentiation of cells. Regulates cell adhesion and differentiation through DSG1/desmoglein-1 and inhibition of the ERK1/ERK2 (MAPK3/MAPK1, respectively) signaling pathway. May also participate in UV radiation-induced apoptosis and have a ligand-independent stimulatory effect on chemotactic cell migration. During development, may function in distinctive aspects of pattern formation and subsequently in development of several fetal tissues. Involved for instance in angiogenesis, in early hindbrain development and epithelial proliferation and branching morphogenesis during mammary gland development. Engaged by the ligand ephrin-A5/EFNA5 may regulate lens fiber cells shape and interactions and be important for lens transparency development and maintenance. With ephrin-A2/EFNA2 may play a role in bone remodeling through regulation of osteoclastogenesis and osteoblastogenesis.|Receptor tyrosine kinase which binds promiscuously transmembrane ephrin-B family ligands residing on adjacent cells, leading to contact-dependent bidirectional signaling into neighboring cells. The signaling pathway downstream of the receptor is referred to as forward signaling while the signaling pathway downstream of the ephrin ligand is referred to as reverse signaling. Cognate/functional ephrin ligands for this receptor include EFNB1, EFNB2 and EFNB3. During nervous system development, regulates retinal axon guidance redirecting ipsilaterally ventrotemporal retinal ganglion cells axons at the optic chiasm midline. This probably requires repulsive interaction with EFNB2. In the adult nervous system together with EFNB3, regulates chemotaxis, proliferation and polarity of the hippocampus neural progenitors. In addition to its role in axon guidance plays also an important redundant role with other ephrin-B receptors in development and maturation of dendritic spines and synapse formation. May also regulate angiogenesis. More generally, may play a role in targeted cell migration and adhesion. Upon activation by EFNB1 and probably other ephrin-B ligands activates the MAPK/ERK and the JNK signaling cascades to regulate cell migration and adhesion respectively. Involved in the maintenance of the pool of satellite cells (muscle stem cells) by promoting their self-renewal and reducing their activation and differentiation (By similarity).|Receptor tyrosine kinase which binds promiscuously transmembrane ephrin-B family ligands residing on adjacent cells, leading to contact-dependent bidirectional signaling into neighboring cells. The signaling pathway downstream of the receptor is referred to as forward signaling while the signaling pathway downstream of the ephrin ligand is referred to as reverse signaling. Functions in axon guidance during development. Involved in the guidance of commissural axons, that form a major interhemispheric connection between the 2 temporal lobes of the cerebral cortex. Also involved in guidance of contralateral inner ear efferent growth cones at the midline and of retinal ganglion cell axons to the optic disk. In addition to axon guidance, also regulates dendritic spines development and maturation and stimulates the formation of excitatory synapses. Upon activation by EFNB1, abolishes the ARHGEF15-mediated negative regulation on excitatory synapse formation. Controls other aspects of development including angiogenesis, palate development and in inner ear development through regulation of endolymph production. Forward and reverse signaling through the EFNB2/EPHB2 complex regulate movement and adhesion of cells that tubularize the urethra and septate the cloaca. May function as a tumor suppressor.
• Uniprot ID: P29317|P29323|P54762
• Molecular Weight: 109 kDa