- Toll Free: 888-880-0001
- Phone: 858-552-6979
- Email: info@avivasysbio.com
- $55: Antibody & Protein in US
- $55 + $25/Kit in US
- Contact us for international orders.
Datasheets/Manuals | Printable datasheet for EPHB1/2 Antibody (Phospho-Tyr594/604) (OAAF07552) |
---|
Predicted Species Reactivity | Human|Mouse|Rat |
---|---|
Clonality | Polyclonal |
Host | Rabbit |
Application | Enzyme-linked immunosorbent assay|Immunocytochemistry|Immunofluorescence|Western blot |
Additional Information | Modification Sites: Human:Y594/Y596 Mouse:Y594/Y604 Rat:Y594/- |
Reconstitution and Storage | -20°C |
Immunogen | The antiserum was produced against synthesized peptide derived from human EPHB1/2 around the phosphorylation site of Tyr594/604. |
Purification | The antibody was purified from rabbit antiserum by affinity-chromatography using phospho peptide. The antibody against non-phospho peptide was removed by chromatography using corresponding non-phospho peptide. |
Peptide Sequence | Synthetic peptide located within the following region: IVCSRKRAYSKEAVYSDKLQHYSTGRGSPGMKIYIDPFTYEDPNEAVREF |
Concentration | 1mg/ml |
Specificity | EPHB1/2 (Phospho-Tyr594/604) Antibody detects endogenous levels of EPHB1/2 only when phosphorylated at Tyr594/604. |
Formulation | Rabbit IgG in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. |
Application Info | WB: 1:500~1:1000 IF: 1:100~1:500 ELISA: 1:1000 |
Gene Symbol | EPHA2|EPHB1|EPHB2 |
---|---|
Gene Full Name | EPH receptor A2|EPH receptor B1|EPH receptor B2 |
Alias Symbols | ARCC2;BDPLT22;CAPB;CTPA;CTPP1;CTRCT6;developmentally-regulated Eph-related tyrosine kinase;DRT;ECK;EK5;EK6;ELK;elk-related tyrosine kinase;eph tyrosine kinase 2;eph tyrosine kinase 3;EPH-like kinase 5;EPH-like kinase 6;ephrin type-A receptor 2;ephrin type-B receptor 1;ephrin type-B receptor 2;EPHT2;EPHT3;Epithelial cell kinase;epithelial cell receptor protein tyrosine kinase;ERK;Hek5;Hek6;NET;neuronally-expressed EPH-related tyrosine kinase;PCBC;protein-tyrosine kinase HEK5;renal carcinoma antigen NY-REN-47;soluble EPHA2 variant 1;soluble EPHB1 variant 1;Tyro5;tyrosine-protein kinase receptor ECK;tyrosine-protein kinase receptor EPH-2;tyrosine-protein kinase receptor EPH-3;tyrosine-protein kinase TYRO5. |
NCBI Gene Id | 1969|2047|2048 |
Protein Name | Ephrin type-A receptor 2|Ephrin type-B receptor 1|Ephrin type-B receptor 2 |
Description of Target | Receptor tyrosine kinase which binds promiscuously membrane-bound ephrin-A family ligands residing on adjacent cells, leading to contact-dependent bidirectional signaling into neighboring cells. The signaling pathway downstream of the receptor is referred to as forward signaling while the signaling pathway downstream of the ephrin ligand is referred to as reverse signaling. Activated by the ligand ephrin-A1/EFNA1 regulates migration, integrin-mediated adhesion, proliferation and differentiation of cells. Regulates cell adhesion and differentiation through DSG1/desmoglein-1 and inhibition of the ERK1/ERK2 (MAPK3/MAPK1, respectively) signaling pathway. May also participate in UV radiation-induced apoptosis and have a ligand-independent stimulatory effect on chemotactic cell migration. During development, may function in distinctive aspects of pattern formation and subsequently in development of several fetal tissues. Involved for instance in angiogenesis, in early hindbrain development and epithelial proliferation and branching morphogenesis during mammary gland development. Engaged by the ligand ephrin-A5/EFNA5 may regulate lens fiber cells shape and interactions and be important for lens transparency development and maintenance. With ephrin-A2/EFNA2 may play a role in bone remodeling through regulation of osteoclastogenesis and osteoblastogenesis.|Receptor tyrosine kinase which binds promiscuously transmembrane ephrin-B family ligands residing on adjacent cells, leading to contact-dependent bidirectional signaling into neighboring cells. The signaling pathway downstream of the receptor is referred to as forward signaling while the signaling pathway downstream of the ephrin ligand is referred to as reverse signaling. Cognate/functional ephrin ligands for this receptor include EFNB1, EFNB2 and EFNB3. During nervous system development, regulates retinal axon guidance redirecting ipsilaterally ventrotemporal retinal ganglion cells axons at the optic chiasm midline. This probably requires repulsive interaction with EFNB2. In the adult nervous system together with EFNB3, regulates chemotaxis, proliferation and polarity of the hippocampus neural progenitors. In addition to its role in axon guidance plays also an important redundant role with other ephrin-B receptors in development and maturation of dendritic spines and synapse formation. May also regulate angiogenesis. More generally, may play a role in targeted cell migration and adhesion. Upon activation by EFNB1 and probably other ephrin-B ligands activates the MAPK/ERK and the JNK signaling cascades to regulate cell migration and adhesion respectively. Involved in the maintenance of the pool of satellite cells (muscle stem cells) by promoting their self-renewal and reducing their activation and differentiation (By similarity).|Receptor tyrosine kinase which binds promiscuously transmembrane ephrin-B family ligands residing on adjacent cells, leading to contact-dependent bidirectional signaling into neighboring cells. The signaling pathway downstream of the receptor is referred to as forward signaling while the signaling pathway downstream of the ephrin ligand is referred to as reverse signaling. Functions in axon guidance during development. Involved in the guidance of commissural axons, that form a major interhemispheric connection between the 2 temporal lobes of the cerebral cortex. Also involved in guidance of contralateral inner ear efferent growth cones at the midline and of retinal ganglion cell axons to the optic disk. In addition to axon guidance, also regulates dendritic spines development and maturation and stimulates the formation of excitatory synapses. Upon activation by EFNB1, abolishes the ARHGEF15-mediated negative regulation on excitatory synapse formation. Controls other aspects of development including angiogenesis, palate development and in inner ear development through regulation of endolymph production. Forward and reverse signaling through the EFNB2/EPHB2 complex regulate movement and adhesion of cells that tubularize the urethra and septate the cloaca. May function as a tumor suppressor. |
Uniprot ID | P29317|P29323|P54762 |
Molecular Weight | 109 kDa |
- Protocol:
- Reconstitution & Storage Instructions
- Western Blotting/Immunoblotting (WB/IB) Protocol
- Immunohistochemistry (IHC) Protocol
- Immunocytochemistry (ICC) Protocol
- Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
- Blocking Peptide Competition Protocol (BPCP)
- Immunoprecipitation (IP) Protocol
- Antibody Array (AA) Protocol
- Tips Information:
-
See our General FAQ page.
-
What is the species homology for "EPHB1/2 Antibody (Phospho-Tyr594/604) (OAAF07552)"?
The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human|Mouse|Rat".
-
How long will it take to receive "EPHB1/2 Antibody (Phospho-Tyr594/604) (OAAF07552)"?
This item is available "Domestic: within 1-2 week delivery | International: 1-2 weeks".
-
What buffer format is "EPHB1/2 Antibody (Phospho-Tyr594/604) (OAAF07552)" provided in?
This item is provided in "".
Additional format options may be available. For more information please contact info@avivasysbio.com. -
What are other names for "EPHB1/2 Antibody (Phospho-Tyr594/604) (OAAF07552)"?
This target may also be called "ARCC2;BDPLT22;CAPB;CTPA;CTPP1;CTRCT6;developmentally-regulated Eph-related tyrosine kinase;DRT;ECK;EK5;EK6;ELK;elk-related tyrosine kinase;eph tyrosine kinase 2;eph tyrosine kinase 3;EPH-like kinase 5;EPH-like kinase 6;ephrin type-A receptor 2;ephrin type-B receptor 1;ephrin type-B receptor 2;EPHT2;EPHT3;Epithelial cell kinase;epithelial cell receptor protein tyrosine kinase;ERK;Hek5;Hek6;NET;neuronally-expressed EPH-related tyrosine kinase;PCBC;protein-tyrosine kinase HEK5;renal carcinoma antigen NY-REN-47;soluble EPHA2 variant 1;soluble EPHB1 variant 1;Tyro5;tyrosine-protein kinase receptor ECK;tyrosine-protein kinase receptor EPH-2;tyrosine-protein kinase receptor EPH-3;tyrosine-protein kinase TYRO5." in publications.
-
What is the shipping cost for "EPHB1/2 Antibody (Phospho-Tyr594/604) (OAAF07552)"?
The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.
-
What is the guarantee for "EPHB1/2 Antibody (Phospho-Tyr594/604) (OAAF07552)"?
All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.
-
Can I get bulk pricing for "EPHB1/2 Antibody (Phospho-Tyr594/604) (OAAF07552)"?
You can get bulk pricing for this item by going here.
-
What is the molecular weight of the protein?
The molecular weight reported by Uniprot for this item is "109 kDa".
Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics. -
What protocols are available for "EPHB1/2 Antibody (Phospho-Tyr594/604) (OAAF07552)"?
We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.
-
What are positive controls for "EPHA2|EPHB1|EPHB2"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What are negative controls for "EPHA2|EPHB1|EPHB2"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What other proteins interact with "EPHA2|EPHB1|EPHB2"?
This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.
-
What biological processes are associated with "EPHA2|EPHB1|EPHB2"?
This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.
-
What cellular components are associated with "EPHA2|EPHB1|EPHB2"?
This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.
-
What protein functions are associated with "EPHA2|EPHB1|EPHB2"?
This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.