Search Antibody, Protein, and ELISA Kit Solutions

EPHA5 Antibody - N-terminal region : FITC (ARP76127_P050-FITC)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP76127_P050 Unconjugated

ARP76127_P050-HRP Conjugated

ARP76127_P050-Biotin Conjugated

Gene Symbol:
NCBI Gene Id:
Swissprot Id:
Alias Symbols:
Replacement Item:
This antibody may replace item sc-1014 from Santa Cruz Biotechnology.
Description of Target:
This gene belongs to the ephrin receptor subfamily of the protein-tyrosine kinase family. EPH and EPH-related receptors have been implicated in mediating developmental events, particularly in the nervous system. Receptors in the EPH subfamily typically have a single kinase domain and an extracellular region containing a Cys-rich domain and 2 fibronectin type III repeats. The ephrin receptors are divided into 2 groups based on the similarity of their extracellular domain sequences and their affinities for binding ephrin-A and ephrin-B ligands. Alternatively spliced transcript variants encoding different isoforms have been described.
Protein Size (# AA):
Molecular Weight:
Affinity purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express EPHA5.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express EPHA5.
The immunogen is a synthetic peptide directed towards the N-terminal region of Human EPHA5
Predicted Species Reactivity:
Peptide Sequence:
Synthetic peptide located within the following region: IELKFTLRDCNSLPGGLGTCKETFNMYYFESDDQNGRNIKENQYIKIDTI
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer.
Reconstitution and Storage:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
0.5 mg/ml
Blocking Peptide:
For anti-EPHA5 (ARP76127_P050-FITC) antibody is Catalog # AAP76127
Printable datasheet for anti-EPHA5 (ARP76127_P050-FITC) antibody
FITC (FAM): Excitation 495 nm/ Emission 520 nm
Target Reference:

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...