Search Antibody, Protein, and ELISA Kit Solutions

EPHA5 Antibody - middle region (ARP58460_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP58460_P050-FITC Conjugated

ARP58460_P050-HRP Conjugated

ARP58460_P050-Biotin Conjugated

Gene Symbol:
Official Gene Full Name:
EPH receptor A5
NCBI Gene Id:
Protein Name:
Ephrin type-A receptor 5
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Replacement Item:
This antibody may replace item sc-1014 from Santa Cruz Biotechnology.
Description of Target:
EPHA5 belongs to the ephrin receptor subfamily of the protein-tyrosine kinase family. EPH and EPH-related receptors have been implicated in mediating developmental events, particularly in the nervous system. Receptors in the EPH subfamily typically have a single kinase domain and an extracellular region containing a Cys-rich domain and 2 fibronectin type III repeats. The ephrin receptors are divided into 2 groups based on the similarity of their extracellular domain sequences and their affinities for binding ephrin-A and ephrin-B ligands. Two transcript variants encoding different isoforms have been found for this gene.This gene belongs to the ephrin receptor subfamily of the protein-tyrosine kinase family. EPH and EPH-related receptors have been implicated in mediating developmental events, particularly in the nervous system. Receptors in the EPH subfamily typically have a single kinase domain and an extracellular region containing a Cys-rich domain and 2 fibronectin type III repeats. The ephrin receptors are divided into 2 groups based on the similarity of their extracellular domain sequences and their affinities for binding ephrin-A and ephrin-B ligands.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express EPHA5.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express EPHA5.
The immunogen is a synthetic peptide directed towards the middle region of human EPHA5
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Tested Species Reactivity:
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Complete computational species homology data:
Anti-EPHA5 (ARP58460_P050)
Peptide Sequence:
Synthetic peptide located within the following region: SDMGYVHRDLAARNILINSNLVCKVSDFGLSRVLEDDPEAAYTTRGGKIP
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-EPHA5 (ARP58460_P050) antibody is Catalog # AAP58460 (Previous Catalog # AAPP34721)
Printable datasheet for anti-EPHA5 (ARP58460_P050) antibody
Target Reference:
Mehrle,A., Nucleic Acids Res. 34 (DATABASE ISSUE), D415-D418 (2006)

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...