Search Antibody, Protein, and ELISA Kit Solutions

EPB41L3 Antibody - N-terminal region : FITC (ARP73951_P050-FITC)

Click here to learn more about Aviva's By-Request Conjugation Service.
100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP73951_P050 Unconjugated

ARP73951_P050-HRP Conjugated

ARP73951_P050-Biotin Conjugated

Click here to learn more about Aviva's By-Request Conjugation Service.
Gene Symbol:
EPB41L3
Official Gene Full Name:
erythrocyte membrane protein band 4.1 like 3
NCBI Gene Id:
23136
Protein Name:
band 4.1-like protein 3
Swissprot Id:
Q9Y2J2-3
Alias Symbols:
4.1B, DAL1, DAL-1
Protein Size (# AA):
612
Molecular Weight:
67kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express EPB41L3.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express EPB41L3.
Immunogen:
The immunogen is a synthetic peptide directed towards the N-terminal region of Human E41L3
Predicted Species Reactivity:
Human
Peptide Sequence:
Synthetic peptide located within the following region: MTTESGSDSESKPDQEAEPQEAAGAQGRAGAPVPEPPKEEQQQALEQFAA
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer.
Reconstitution and Storage:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Concentration:
1 mg/ml
Protein Interactions:
HUWE1; TCF4; ASB3; FBXO6; YWHAB; MBIP; GSK3B; YWHAQ; Dlg4; UBC; SMURF1; EIF4A3; MAGOH; PSEN1; PAXIP1; ATXN1L; SIRT7; ARRB2; ELAVL1; UNC13A; CEP152; YWHAG; YWHAZ; SMYD2; IGSF21; CADM1; CNTNAP2; CLNS1A; YWHAH; SPTBN1; PLA2G2A; CD44;
Blocking Peptide:
For anti-EPB41L3 (ARP73951_P050-FITC) antibody is Catalog # AAP73951
Datasheets/Manuals:
Printable datasheet for anti-EPB41L3 (ARP73951_P050-FITC) antibody
Conjugation:
FITC (FAM): Excitation 495 nm/ Emission 520 nm

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...