EPB2 Recombinant Protein (Barley) (OPCA03135)

Catalog No: OPCA03135

EPB2 Recombinant Protein (Hordeum vulgare) (OPCA03135) in SDS-PAGE showing the molecular weight of approximately 41.3 kDa.

Product Info

• Predicted Species Reactivity: Barley|Hordeum vulgare
• Product Format: Liquid or Lyophilized powder
• Host: Hordeum vulgare
• Reconstitution and Storage: -20°C or -80°C
• Formulation: 20 mM Tris-HCl based buffer, pH 8.0
• Purity: Greater than 90% as determined by SDS-PAGE.
• Peptide Sequence: LPPSVDWRQKGAVTGVKDQGKCGSCWAFSTVVSVEGINAIRTGSLVSLSEQELIDCDTADNDGCQGGLMDNAFEYIKNNGGLITEAAYPYRAARGTCNVARAAQNSPVVVHIDGHQDVPANSEEDLARAVANQPVSVAVEASGKAFMFYSEGVFTGECGTELDHGVAVVGYGVAEDGKAYWTVKNSWGPSWGEQGYIRVEKDSGASGGLCGIAMEASYPVKTYSKPKPTPRRALGARESL
• Protein Sequence: LPPSVDWRQKGAVTGVKDQGKCGSCWAFSTVVSVEGINAIRTGSLVSLSEQELIDCDTADNDGCQGGLMDNAFEYIKNNGGLITEAAYPYRAARGTCNVARAAQNSPVVVHIDGHQDVPANSEEDLARAVANQPVSVAVEASGKAFMFYSEGVFTGECGTELDHGVAVVGYGVAEDGKAYWTVKNSWGPSWGEQGYIRVEKDSGASGGLCGIAMEASYPVKTYSKPKPTPRRALGARESL
• Storage Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: E.coli
• Protein Range: 134-373 aa
• Tag: N-terminal 6xHis-SUMO-tagged

Target Info

• Reference: Hormonal regulation, processing, and secretion of cysteine proteinases in barley aleurone layers.Koehler S.M., Ho T.H.D.Plant Cell 2:769-783(1990)
• Gene Symbol: EPB2
• Alias Symbols: EPB2, Cysteine proteinase EP-B 2, EC 3.4.22.-
• Protein Name: Cysteine proteinase EP-B 2
• Uniprot ID: P25250
• Protein Size (# AA): Recombinant
• Molecular Weight: 41.3 kDa