SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP37036_P050
Price: $0.00
SKU
ARP37036_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-Eomes (ARP37036_P050) antibody
Product Info
Tested Species ReactivityHuman, Mouse
Predicted Species ReactivityMouse, Rat, Cow, Dog, Guinea Pig
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationIHC, WB
Additional InformationIHC Information: Paraffin embedded placenta tissue, tested with an antibody dilution of 5 ug/ml.
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the C terminal region of human Eomes
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 80%; Dog: 80%; Guinea Pig: 80%; Mouse: 100%; Rat: 87%
Peptide SequenceSynthetic peptide located within the following region: SSDSGVYNSACKRKRLSPSTPSNGNSPPIKCEDINTEEYSKDTSKGMGAY
Concentration0.5 mg/ml
Blocking PeptideFor anti-Eomes (ARP37036_P050) antibody is Catalog # AAP37036 (Previous Catalog # AAPS06801)
Gene SymbolEomes
Gene Full NameEomesodermin homolog (Xenopus laevis)
Alias SymbolsTbr, Tbr2, TBR-2, C77258
NCBI Gene Id13813
Protein NameEomesodermin homolog
Description of TargetEomes functions as a transcriptional activator playing a crucial role during development. Eomes functions in trophoblast differentiation and later in gastrulation, regulating both mesoderm delamination and endoderm specification.Eomes plays a role in brain development being required for the specification and the proliferation of the intermediate progenitor cells and their progeny in the cerebral cortex. Eomes also involved in the differentiation of CD8+ T-cells during immune response regulating the expression of lytic effector genes.
Uniprot IDO54839
Protein Accession #NP_034266
Nucleotide Accession #NM_010136
Protein Size (# AA)707
Molecular Weight75kDa
  1. What is the species homology for "Eomes Antibody - C-terminal region (ARP37036_P050)"?

    The tested species reactivity for this item is "Human, Mouse". This antibody is predicted to have homology to "Mouse, Rat, Cow, Dog, Guinea Pig".

  2. How long will it take to receive "Eomes Antibody - C-terminal region (ARP37036_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "Eomes Antibody - C-terminal region (ARP37036_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "Eomes Antibody - C-terminal region (ARP37036_P050)"?

    This target may also be called "Tbr, Tbr2, TBR-2, C77258" in publications.

  5. What is the shipping cost for "Eomes Antibody - C-terminal region (ARP37036_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "Eomes Antibody - C-terminal region (ARP37036_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "Eomes Antibody - C-terminal region (ARP37036_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "75kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "Eomes Antibody - C-terminal region (ARP37036_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "EOMES"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "EOMES"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "EOMES"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "EOMES"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "EOMES"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "EOMES"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:Eomes Antibody - C-terminal region (ARP37036_P050)
Your Rating
We found other products you might like!