ENOSF1 Antibody - N-terminal region (ARP56963_P050)

Catalog No: ARP56963_P050

WB Suggested Anti-ENOSF1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: MCF7 cell lysateENOSF1 is strongly supported by BioGPS gene expression data to be expressed in Human MCF7 cells

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Cow, Dog, Guinea Pig, Horse, Rabbit, Yeast, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ENOSF1
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Rabbit: 100%; Yeast: 100%; Zebrafish: 85%
• Peptide Sequence: Synthetic peptide located within the following region: MVRGRISRLSVRDVRFPTSLGGHGADAMHTDPDYSAAYVVIETDAEDGIK
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-ENOSF1 (ARP56963_P050) antibody is Catalog # AAP56963 (Previous Catalog # AAPP39908)
• Sample Type Confirmation:

  ENOSF1 is strongly supported by BioGPS gene expression data to be expressed in MCF7

Target Info

• Reference: Giusti,B., (er) Biochem. Genet. (2008) In press
• Gene Symbol: ENOSF1
• Gene Full Name: Enolase superfamily member 1
• Alias Symbols: RTS, FUCD, TYMSAS
• NCBI Gene Id: 55556
• Protein Name: Mitochondrial enolase superfamily member 1
• Description of Target: This gene was originally identified as a naturally occurring antisense transcript to the human thymidylate synthase gene. Alternate splice variants have been described, one of which (named rTSalpha) represents an alternate 3'UTR that is complementary to t
• Uniprot ID: Q7L5Y1
• Protein Accession #: NP_059982
• Nucleotide Accession #: NM_017512
• Protein Size (# AA): 443
• Molecular Weight: 50kDa
• Protein Interactions: UBC;