ENOPH1 Antibody - middle region (ARP57530_P050)

Catalog No: ARP57530_P050

WB Suggested Anti-ENOPH1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Human brain

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Yeast
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ENOPH1
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Yeast: 92%
• Peptide Sequence: Synthetic peptide located within the following region: TDVTREASAAEEADVHVAVVVRPGNAGLTDDEKTYYSLITSFSELYLPSS
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-ENOPH1 (ARP57530_P050) antibody is Catalog # AAP57530 (Previous Catalog # AAPP44038)

Target Info

• Gene Symbol: ENOPH1
• Gene Full Name: Enolase-phosphatase 1
• Alias Symbols: E1, MASA, mtnC, MST145
• NCBI Gene Id: 58478
• Protein Name: Enolase-phosphatase E1
• Description of Target: ENOPH1 is a bifunctional enzyme that catalyzes the enolization of 2,3-diketo-5-methylthiopentyl-1-phosphate (DK-MTP-1-P) into the intermediate 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate (HK-MTPenyl-1-P), which is then dephosphorylated to form the acireductone 1,2-dihydroxy-3-keto-5-methylthiopentene (DHK-MTPene).
• Uniprot ID: Q9UHY7
• Protein Accession #: NP_067027
• Nucleotide Accession #: NM_021204
• Protein Size (# AA): 261
• Molecular Weight: 29kDa
• Protein Interactions: UBC; RAB10; RPS27;