Catalog No: OPCD05813
Price: $0.00
SKU
OPCD05813
Availability: Domestic: within 1-2 weeks delivery | International: within 1-2 weeks delivery
Contact Us:
- Toll Free: 888-880-0001
- Phone: 858-552-6979
- Email: info@avivasysbio.com
Shipping Info:
- $55: Antibody & Protein in US
- $55 + $25/Kit in US
- Contact us for international orders.
Datasheets/Manuals | Printable datasheet for ENO2 Recombinant Protein (OPCD05813) |
---|
Predicted Species Reactivity | Homo sapiens|Human |
---|---|
Product Format | Freeze-dried Powder. PBS, pH7.4, containing 0.01% SKL, 5% Trehalose. |
Host | E.coli |
Conjugation | Unconjugated |
Application | Positive control|Sodium sodecyl sulfate - polyacrylamide gel electrophoresis|Western blot |
Additional Information | Endotoxin Level: < 1.0 EU per 1 ug (determined by the LAL method) |
:: | Residues: Ser2-Leu285+TILWSPLRTHLTRMIGLPGPSSQPCRDPDCGVMT |
:: | Subcellular Location: Cytoplasm. Cell membrane |
Reconstitution and Storage | 2°C to 8°C|-80°C |
Concentration | 200 ug/mL (prior to lyoph) |
Purity | > 97% |
Source | E.coli |
Tag | N-terminal His Tag |
Gene Symbol | ENO2 |
---|---|
Gene Full Name | enolase 2 |
Alias Symbols | 2-phospho-D-glycerate hydrolyase;2-phospho-D-glycerate hydro-lyase;Enolase 2;enolase 2 (gamma, neuronal);epididymis secretory protein Li 279;gamma-enolase;HEL-S-279;neural enolase;neuron specific gamma enolase;neuronal enriched enolase;neurone-specific enolase;neuron-specific enolase;NSE. |
NCBI Gene Id | 2026 |
Protein Name | Gamma-enolase |
Description of Target | Has neurotrophic and neuroprotective properties on a broad spectrum of central nervous system (CNS) neurons. Binds, in a calcium-dependent manner, to cultured neocortical neurons and promotes cell survival (By similarity). |
Uniprot ID | P09104 |
Protein Accession # | NP_001966.1 |
Nucleotide Accession # | NM_001975.2 |
Protein Size (# AA) | Ser2~Arg285 |
Molecular Weight | 48kDa |
- Protocol:
- Reconstitution & Storage Instructions
- Western Blotting/Immunoblotting (WB/IB) Protocol
- Immunohistochemistry (IHC) Protocol
- Immunocytochemistry (ICC) Protocol
- Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
- Blocking Peptide Competition Protocol (BPCP)
- Immunoprecipitation (IP) Protocol
- Antibody Array (AA) Protocol
- Tips Information:
-
See our General FAQ page.
Write Your Own Review
We found other products you might like!