ENO2 Recombinant Protein (OPCD05813)

Catalog No: OPCD05813

ENO2 Recombinant Protein (OPCD05813) using SDS-PAGE

ENO2 Recombinant Protein (OPCD05813) using SDS-PAGE

Product Info

• Predicted Species Reactivity: Homo sapiens|Human
• Product Format: Freeze-dried Powder. PBS, pH7.4, containing 0.01% SKL, 5% Trehalose.
• Host: E.coli
• Conjugation: Unconjugated
• Application: Positive control|Sodium sodecyl sulfate - polyacrylamide gel electrophoresis|Western blot
• Additional Information: Endotoxin Level: < 1.0 EU per 1 ug (determined by the LAL method)
  Residues: Ser2-Leu285+TILWSPLRTHLTRMIGLPGPSSQPCRDPDCGVMT
  Subcellular Location: Cytoplasm. Cell membrane
• Reconstitution and Storage: 2°C to 8°C|-80°C
• Concentration: 200 ug/mL (prior to lyoph)
• Purity: > 97%
• Source: E.coli
• Tag: N-terminal His Tag

Target Info

• Gene Symbol: ENO2
• Gene Full Name: enolase 2
• Alias Symbols: 2-phospho-D-glycerate hydrolyase;2-phospho-D-glycerate hydro-lyase;Enolase 2;enolase 2 (gamma, neuronal);epididymis secretory protein Li 279;gamma-enolase;HEL-S-279;neural enolase;neuron specific gamma enolase;neuronal enriched enolase;neurone-specific enolase;neuron-specific enolase;NSE.
• NCBI Gene Id: 2026
• Protein Name: Gamma-enolase
• Description of Target: Has neurotrophic and neuroprotective properties on a broad spectrum of central nervous system (CNS) neurons. Binds, in a calcium-dependent manner, to cultured neocortical neurons and promotes cell survival (By similarity).
• Uniprot ID: P09104
• Protein Accession #: NP_001966.1
• Nucleotide Accession #: NM_001975.2
• Protein Size (# AA): Ser2~Arg285
• Molecular Weight: 48kDa