Size:100 ul
In stock
Request Bulk
Order Quote
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email:
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP60777_P050 Unconjugated

ARP60777_P050-HRP Conjugated

ARP60777_P050-Biotin Conjugated

ENO2 Antibody - middle region : FITC (ARP60777_P050-FITC)

Catalog#: ARP60777_P050-FITC
Domestic: within 1-2 days delivery International: 1-2 days
More Information
Predicted Species Reactivity Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Product Format Liquid. Purified antibody supplied in 1x PBS buffer.
Clonality Polyclonal
Host Rabbit
Conjugation FITC (FAM): Excitation 495 nm/ Emission 520 nm
Application WB
Reconstitution and Storage All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Replacement Item This antibody may replace item sc-120040 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human ENO2
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 93%; Zebrafish: 93%
Complete computational species homology data Anti-ENO2 (ARP60777_P050)
Peptide Sequence Synthetic peptide located within the following region: ESFRDAMRLGAEVYHTLKGVIKDKYGKDATNVGDEGGFAPNILENSEALE
Concentration 0.5 mg/ml
Blocking Peptide For anti-ENO2 (ARP60777_P050-FITC) antibody is Catalog # AAP60777 (Previous Catalog # AAPP46966)
Datasheets/Manuals Printable datasheet for anti-ENO2 (ARP60777_P050-FITC) antibody

Choudhuri, A., Maitra, U. & Evans, T. Translation initiation factor eICC/IF3h targets specICC/IFic transcripts to polysomes during embryogenesis. Proc. Natl. Acad. Sci. U. S. A. 110, 9818-23 (2013). WB, Bovine, Human, Dog, Horse, Rabbit, Rat, Goat, Guinea pig, Mouse, Zebrafish, Sheep 23716667

Gene Symbol ENO2
Official Gene Full Name Enolase 2 (gamma, neuronal)
Alias Symbols NSE
NCBI Gene Id 2026
Protein Name Gamma-enolase
Description of Target This gene encodes one of the three enolase isoenzymes found in mammals. This isoenzyme, a homodimer, is found in mature neurons and cells of neuronal origin. A switch from alpha enolase to gamma enolase occurs in neural tissue during development in rats and primates.
Swissprot Id P09104
Protein Accession # NP_001966
Nucleotide Accession # NM_001975
Protein Size (# AA) 434
Molecular Weight 47kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express ENO2.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express ENO2.
Write Your Own Review
You're reviewing:ENO2 Antibody - middle region : FITC (ARP60777_P050-FITC)
Your Rating